NDRG1 Antibody (2D7)

Images

 
Immunocytochemistry/ Immunofluorescence: NDRG1 Antibody (2D7) [H00010397-M03] - Analysis of monoclonal antibody to NDRG1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: NDRG1 Antibody (2D7) [H00010397-M03] - Analysis of monoclonal antibody to NDRG1 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 0.7 ug/ml
ELISA: NDRG1 Antibody (2D7) [H00010397-M03] - Detection limit for recombinant GST tagged NDRG1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2D7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NDRG1 Antibody (2D7) Summary

Immunogen
NDRG1 (AAH03175, 1 a.a. ~ 394 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
Specificity
NDRG1 - N-myc downstream regulated gene 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDRG1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein for Western Blot.
Publications
Read Publications using
H00010397-M03 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDRG1 Antibody (2D7)

  • CAP43
  • CMT4D
  • Differentiation-related gene 1 protein
  • DRG1
  • DRG-1
  • DRG1HMSNL
  • GC4
  • HMSNL
  • NDR1
  • NDRG1
  • Nickel-specific induction protein Cap43
  • NMSL
  • N-myc downstream regulated 1
  • N-myc downstream-regulated gene 1 protein
  • protein NDRG1
  • protein regulated by oxygen-1
  • PROXY1
  • Reducing agents and tunicamycin-responsive protein
  • RIT42
  • RTP
  • RTPGC4
  • TARG1
  • TDD5
  • tunicamycin-responsive protein

Background

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein involved in stress responses, hormone responses, cell growth, and differentiation. Mutation in this gene has been reported to be causative for hereditary motor and sensory neuropathy-Lom.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-109
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
NBP2-45983
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
3218-ND/CF
Species: Hu
Applications: BA
H00011329-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
DVE00
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00057447-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-97572
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vivo, KD, Simple Western, WB
NBP2-67561
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IP, WB
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
NBP1-86046
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, PLA, Simple Western, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
H00010397-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for NDRG1 Antibody (H00010397-M03)(5)

Reviews for NDRG1 Antibody (H00010397-M03) (0)

There are no reviews for NDRG1 Antibody (H00010397-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDRG1 Antibody (H00010397-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDRG1 Products

Bioinformatics Tool for NDRG1 Antibody (H00010397-M03)

Discover related pathways, diseases and genes to NDRG1 Antibody (H00010397-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDRG1 Antibody (H00010397-M03)

Discover more about diseases related to NDRG1 Antibody (H00010397-M03).
 

Pathways for NDRG1 Antibody (H00010397-M03)

View related products by pathway.

PTMs for NDRG1 Antibody (H00010397-M03)

Learn more about PTMs related to NDRG1 Antibody (H00010397-M03).
 

Research Areas for NDRG1 Antibody (H00010397-M03)

Find related products by research area.

Blogs on NDRG1.

Suppressing breast cancer metastasis: The role of hypoxia-induced RhoB expression and activation
By Jamshed Arslan, Pharm. D., PhD. The Ras homologous (Rho) GTPase family of signaling molecules has over 20 members, which typically cycle between active (GTP-bound) and inactive (GDP-bound) states. These small GTPa...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDRG1 Antibody (2D7) and receive a gift card or discount.

Bioinformatics

Gene Symbol NDRG1
Entrez
OMIM
Uniprot