NCOR1 Recombinant Protein Antigen

Images

 
There are currently no images for NCOR1 Recombinant Protein Antigen (NBP2-48997PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NCOR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCOR1.

Source: E. coli

Amino Acid Sequence: PPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCOR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48997.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NCOR1 Recombinant Protein Antigen

  • hN-CoR
  • KIAA1047
  • KIAA1047N-CoR1
  • MGC104216
  • N-CoR
  • NCOR1
  • N-CoRhCIT529I10
  • nuclear receptor corepressor 1
  • nuclear receptor co-repressor 1
  • thyroid hormone- and retinoic acid receptor-associated corepressor 1
  • TRAC1

Background

NCOR encodes a protein that mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which also includes histone deacetylases and transcriptional regulators similar to the yeast protein Sin3p. This gene is located between the Charcot-Marie-Tooth and Smith-Magenis syndrome critical regions on chromosome 17. An alternatively spliced transcript variant has been described, but its full length sequence has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-5802
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-86919
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-92243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PLA, WB
MAB7428
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-55747
Species: Hu
Applications: ICC/IF, WB
NBP1-90256
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-48997PEP
Species: Hu
Applications: AC

Publications for NCOR1 Recombinant Protein Antigen (NBP2-48997PEP) (0)

There are no publications for NCOR1 Recombinant Protein Antigen (NBP2-48997PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOR1 Recombinant Protein Antigen (NBP2-48997PEP) (0)

There are no reviews for NCOR1 Recombinant Protein Antigen (NBP2-48997PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NCOR1 Recombinant Protein Antigen (NBP2-48997PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCOR1 Products

Array NBP2-48997PEP

Research Areas for NCOR1 Recombinant Protein Antigen (NBP2-48997PEP)

Find related products by research area.

Blogs on NCOR1.

Muscular Dystrophy Regulation: Ezh2, NCoR-1
Over the years muscular dystrophies have become a popular area of research. These are a group of inherited disorders that involve an increase in muscle weakness over time. These disorders greatly decrease the quality of life and there are no known cur...  Read full blog post.

NCOR & EZH2 in Muscular Dystrophy
Over the years muscular dystrophies have become a popular area of research. These are a group of inherited disorders that involve an increase in muscle weakness over time. These disorders greatly decrease the quality of life and there are no known cur...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NCOR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NCOR1