NCOA7 Antibody - BSA Free

Immunohistochemistry-Paraffin: NCOA7 Antibody [NBP1-85200] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: NCOA7 Antibody [NBP1-85200] - Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.

Immunohistochemistry-Paraffin: NCOA7 Antibody [NBP1-85200] - Staining of human kidney shows moderate nuclear positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: NCOA7 Antibody [NBP1-85200] - Staining of human stomach shows moderate nuclear positivity in subset of glandular cells.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NCOA7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NCOA7 Antibody - BSA Free (NBP1-85200) is a polyclonal antibody validated for use in IHC. Anti-NCOA7 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HGSPTVTKLSKEPSDTSAAFESTAKENFLGEDDDFVDLEELSSQTGGGMHKKDTLKECLSLDPEERKKAESQINNSAVEMQVQS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCOA7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NCOA7 Protein (NBP1-85200PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26442671).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NCOA7 Antibody - BSA Free

• 140 kDa estrogen receptor-associated protein
• dJ187J11.3
• ERAP140Nbla00052
• ESNA1
• Estrogen nuclear receptor coactivator 1
• estrogen receptor associated protein 140 kDa
• FLJ45605
• MGC88425
• Nbla10993
• nuclear receptor coactivator 7
• putative protein product of Nbla00052
• putative protein product of Nbla10993

Background

Enhances the transcriptional activities of several nuclear receptors. Involved in the coactivation ofdifferent nuclear receptors, such as ESR1, THRB, PPARG and RARA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NCOA7 Antibody (NBP1-85200)(2)

Publications using NBP1-85200

• Cutler AA, Pawlikowski B, Wheeler JR et al. The regenerating skeletal muscle niche drives satellite cell return to quiescence iScience 2022-06-17 [PMID: 35733848]
• Merkulova M, Paunescu TG, Azroyan A et al. Mapping the H(+) (V)-ATPase interactome: identification of proteins involved in trafficking, folding, assembly and phosphorylation. Sci Rep 2015-01-01 [PMID: 26442671]

Bioinformatics

• Gene Symbol: NCOA7