NCOA6 Recombinant Protein Antigen

Images

 
There are currently no images for NCOA6 Protein (NBP1-89193PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NCOA6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCOA6.

Source: E.coli

Amino Acid Sequence: NQNVQHAGGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSGVPQVNLSNMQGQPQQGPPSQLMGMHQQIVPSQGQMVQQQGTLNPQNPMILSRAQLMPQGQMMVNPPSQNLGPSPQRMTPPKQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCOA6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89193.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for NCOA6 Recombinant Protein Antigen

  • Activating signal cointegrator 2
  • AIB3NRC RAP250
  • Amplified in breast cancer protein 3
  • ASC-2
  • Cancer-amplified transcriptional coactivator ASC-2
  • KIAA0181PPAR-interacting protein
  • NRCamplified in breast cancer-3 protein
  • nuclear receptor coactivator 6
  • Nuclear receptor coactivator RAP250
  • Nuclear receptor-activating protein, 250 kDa
  • peroxisome proliferator-activated receptor interacting protein
  • PRIPPeroxisome proliferator-activated receptor-interacting protein
  • RAP250Thyroid hormone receptor-binding protein
  • thyroid hormone receptor binding protein
  • TRBPASC2activating signal cointegrator-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5520
Species: Hu, Mu
Applications: WB
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-591
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-65110
Species: Hu
NBP2-12553
Species: Hu
NBP1-85806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NCOA6 Protein (NBP1-89193PEP) (0)

There are no publications for NCOA6 Protein (NBP1-89193PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA6 Protein (NBP1-89193PEP) (0)

There are no reviews for NCOA6 Protein (NBP1-89193PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for NCOA6 Protein (NBP1-89193PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for NCOA6 Protein (NBP1-89193PEP)

Discover related pathways, diseases and genes to NCOA6 Protein (NBP1-89193PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA6 Protein (NBP1-89193PEP)

Discover more about diseases related to NCOA6 Protein (NBP1-89193PEP).
 

Pathways for NCOA6 Protein (NBP1-89193PEP)

View related products by pathway.

PTMs for NCOA6 Protein (NBP1-89193PEP)

Learn more about PTMs related to NCOA6 Protein (NBP1-89193PEP).
 

Research Areas for NCOA6 Protein (NBP1-89193PEP)

Find related products by research area.

Blogs on NCOA6. Showing 1-10 of 49 blog posts - Show all blog posts.

ASC-2: An important co-activator of different nuclear receptors
ASC-2, also known as Nuclear Receptor Co-Activator 6, directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. It is involved in the co-activation of different nuclear receptors, such as for steroi...  Read full blog post.

ASC-2: An important co-activator of different nuclear receptors
ASC-2, also known as Nuclear Receptor Co-Activator 6, directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. It is involved in the co-activation of different nuclear receptors, such as for steroi...  Read full blog post.

ASC-2: An important co-activator of different nuclear receptors
ASC-2, also known as Nuclear Receptor Co-Activator 6, directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. It is involved in the co-activation of different nuclear receptors, such as for steroi...  Read full blog post.

ASC-2: An important co-activator of different nuclear receptors
ASC-2, also known as Nuclear Receptor Co-Activator 6, directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. It is involved in the co-activation of different nuclear receptors, such as for steroi...  Read full blog post.

ASC-2: An important co-activator of different nuclear receptors
ASC-2, also known as Nuclear Receptor Co-Activator 6, directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. It is involved in the co-activation of different nuclear receptors, such as for steroi...  Read full blog post.

ASC-2: An important co-activator of different nuclear receptors
ASC-2, also known as Nuclear Receptor Co-Activator 6, directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. It is involved in the co-activation of different nuclear receptors, such as for steroi...  Read full blog post.

ASC-2: An important co-activator of different nuclear receptors
ASC-2, also known as Nuclear Receptor Co-Activator 6, directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. It is involved in the co-activation of different nuclear receptors, such as for steroi...  Read full blog post.

ASC-2: An important co-activator of different nuclear receptors
ASC-2, also known as Nuclear Receptor Co-Activator 6, directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. It is involved in the co-activation of different nuclear receptors, such as for steroi...  Read full blog post.

ASC-2: An important co-activator of different nuclear receptors
ASC-2, also known as Nuclear Receptor Co-Activator 6, directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. It is involved in the co-activation of different nuclear receptors, such as for steroi...  Read full blog post.

ASC-2: An important co-activator of different nuclear receptors
ASC-2, also known as Nuclear Receptor Co-Activator 6, directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. It is involved in the co-activation of different nuclear receptors, such as for steroi...  Read full blog post.

Showing 1-10 of 49 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

NCOA6 Antibody
NB200-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NCOA6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NCOA6