Recombinant Human NCOA2 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human NCOA2 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1365-1464 of Human NCOA2
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: SMFSQQSPPHFGQQANTSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGGNLFPNQLPGMDMIKQEGDTTRKYC

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: NCOA2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Immunohistochemistry
  • Protein Array
  • Western Blot
• Application Notes: Immunohistochemistry was reported in scientific literature.
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NCOA2 GST (N-Term) Protein

• bHLHe75
• bHLHe75MGC138808
• Class E basic helix-loop-helix protein 75
• EC 2.3.1.48
• GRIP1glucocorticoid receptor-interacting protein-1
• HTIF2
• KAT13C
• NCOA2
• NCoA-2SRC2
• nuclear receptor coactivator 2
• TIF2
• TIF2hTIF2
• Transcriptional intermediary factor 2

Background

Steroid and thyroid hormones and retinoic acid regulate a complex array of gene expression activity via intracellular receptor transcription factors belonging to the ligand dependent nuclear receptor superfamily. Adding to the complexity of function of these transcription factors are associated proteins known as coactivators and corepressors which, as their names suggest, enhance or depress transcriptional activity of the nuclear receptor with which they associate. One such coactivator is Steroid Receptor Coactivator-2 (SRC2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for NCOA2 Partial Recombinant Protein (H00010499-Q01)(1)

Publication using H00010499-Q01

• Tognoni CM, Chadwick JG Jr, Ackeifi CA, Tetel MJ. Nuclear receptor coactivators are coexpressed with steroid receptors and regulated by estradiol in mouse brain. Neuroendocrinology;94(1):49-57. 2011-01-01 [PMID: 21311177] (IF/IHC)

Bioinformatics

• Gene Symbol: NCOA2