Home » NCOA2 » NCOA2 Proteins » Recombinant Human NCOA2 GST (N-Term) Protein

Recombinant Human NCOA2 GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human NCOA2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1365-1464 of Human NCOA2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SMFSQQSPPHFGQQANTSMYSNNMNINVSMATNTGGMSSMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGGNLFPNQLPGMDMIKQEGDTTRKYC
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NCOA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
Immunohistochemistry was reported in scientific literature.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00010499-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NCOA2 GST (N-Term) Protein

  • bHLHe75
  • bHLHe75MGC138808
  • Class E basic helix-loop-helix protein 75
  • EC 2.3.1.48
  • GRIP1glucocorticoid receptor-interacting protein-1
  • HTIF2
  • KAT13C
  • NCOA2
  • NCoA-2SRC2
  • nuclear receptor coactivator 2
  • TIF2
  • TIF2hTIF2
  • Transcriptional intermediary factor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SRC1 Antibody
(1135)
NB200-310
Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Mouse tissue (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with SRC1 antibody [1135] diluted at 1:2000.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, IP
NCOA3/AIB1 Antibody
NB100-314
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Detection of Human SRC3 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SRC3 antibody NB100-314 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Nuclear extract (5 mcg for WB, 10 mg for CoIP) from HeLa cells. Affinity purified rabbit anti-SRC3 used at 0.33 mcg/ml for WB and 20 mcg/10 mg extract for CoIP.
(1 Review)
(4 Publications)
Species: Hu
Applications: WB, IP
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(13 Publications)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ChIP, IP
MYBBP1A Antibody
NB100-61050
Immunohistochemistry-Paraffin: MYBBP1A Antibody [NB100-61050] - Human colon carcinoma. Antibody: Affinity purified rabbit anti-MYBBP1A used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: MYBBP1A Antibody [NB100-61050] - Detection of human MYBBP1A by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-MYBBP1A antibody NB100-61050 used for IP at 3 ug per reaction. MYBBP1A was also immunoprecipitated by rabbit anti-MYBBP1A antibody NB100-61051. For blotting immunoprecipitated MYBBP1A, NB100-61051 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
PELP1 Antibody
NB200-331
Western Blot: PELP1 Antibody [NB200-331] - Detection of mouse PELP1/MNAR by western blot. Samples: Whole cell lysate (50 ug) from NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-PELP1/MNAR antibody NB200-331 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunohistochemistry-Paraffin: PELP1 Antibody [NB200-331] - Human ovarian carcinoma.~ Antibodies: Affinity purified rabbit anti-PELP1/MNAR used at a dilution of 1:2,500 (0.4ug/ml) (left) used at a dilution of 1:5,000 (0.2ug/ml) (right). Detection: DAB.
Western Blot: PELP1 Antibody [NB200-331] - Detection of Human PELP1/MNAR by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-PELP1/MNAR antibody NB200-331 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
(18 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MSH6 Antibody (3E1)
NBP2-37537
Western Blot: MSH6 Antibody (3E1) [NBP2-37537] - Western blot analysis using MSH6 mouse mAb against HEK293 (1), HCT116 (2), A549 (3), A431 (4), MCF-7 (5) and HepG2 (6) cell lysate.
Immunocytochemistry/Immunofluorescence: MSH6 Antibody (3E1) [NBP2-37537] - Immunofluorescence analysis of Hela cells using MSH6 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: MSH6 Antibody (3E1) [NBP2-37537] - Analysis of colon cancer tissues using MSH6 mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
GR/NR3C1 Antibody
(BuGR2)
NB300-731
Western Blot: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of glucocorticoid receptor on mouse liver extract.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in U251 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(3 Reviews)
(11 Publications)
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
KAT3B/p300
Antibody (RW105)
NB100-616
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.
Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B/p300 Antibody (RW105) NB100-616 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(9 Publications)
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
MCG10 Antibody
NBP1-76729
Western Blot: MCG10 Antibody [NBP1-76729] - HeLa cell lysate with MCG10 antibody at (A) 0.5, (B) 1 and (C) 2 u/mL.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - HeLa cells with MCG10 antibody at 1 ug/ml.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - Hela cells.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line and Raji human Burkitt's lymphoma cell line. PVDF Membrane was probed with 1 µg/mL of Human PAG1 Polyclonal Antibody (Catalog # MAB5285) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for PAG1 at approximately 70-85 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Raji human Burkitt's lymphoma cell line and Daudi human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for PAG1 at approximately 76 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human PAG1 Monoclonal Antibody (Catalog # MAB5285). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu
Applications: WB, Simple Western
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot: Opsin 1 (Long Wave) Antibody [NBP3-09392] - Western blot analysis of Opsin 1 (Long Wave) in Fetal Heart lysates. Antibody dilution at 1.0ug/ml
Species: Hu, Mu
Applications: WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot: eIF4E [p Ser209] Antibody [NB100-81898] - Analysis of extracts from SK-BR-3 cells, untreated or insulin and EGF treated, and pretreated with U0126 cells, using eIF4E (Phospho-Ser209) Antibody.
Immunocytochemistry/Immunofluorescence: eIF4E [p Ser209] Antibody [NB100-81898] - Staining of methanol-fixed MCF cells using eIF4E(Phospho-Ser209) antibody
Immunohistochemistry: eIF4E [p Ser209] Antibody [NB100-81898] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using elF4E (phospho-Ser209) antibody
(1 Publication)
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
Amphiregulin
[Biotin]
DY262
(1 Review)
(34 Publications)
Species: Hu
AKR1B1 Antibody
NBP1-89146
Immunocytochemistry/Immunofluorescence: AKR1B1 Antibody [NBP1-89146] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining in human adrenal gland and lymph node tissues using NBP2-38530 antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ER alpha/NR3A1
Antibody
NB100-81909
Western Blot: ER alpha/NR3A1 Antibody [NB100-81909] - Analysis of extracts from MCF7 cells using Estrogen Receptor-alpha (Ab-106) antibody and Estrogen Receptor-alpha (phospho-Ser106) antibody.
Immunocytochemistry/Immunofluorescence: ER alpha/NR3A1 Antibody [NB100-81909] - ICC/IF showing estrogen receptor alpha (green) in human cervical stromal cells. Nuclei are stained with DAPI (blue). Antibody at 1:200 in 3% BSA. ICC/IF image submitted by a verified customer review.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody [NB100-81909] - Analysis of paraffin-embedded human breast carcinoma tissue using Estrogen Receptor-alpha antibody.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Glutathione
Reductase Antibody
NBP2-16684
Western Blot: Glutathione Reductase Antibody [NBP2-16684] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Glutathione Reductase antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: Glutathione Reductase Antibody [NBP2-16684] - Paraffin-embedded rat brain. Glutathione reductase antibody [N2C2], Internal diluted at 1:500.
Western Blot: Glutathione Reductase Antibody [NBP2-16684] - Sample (30 ug of whole cell lysate) A: HCT116 7. 5% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Recombinant Human
NCOA2 GST (N-Term) Pr ...
H00010499-Q01
Recombinant Human NCOA2 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, IHC, PA, AP

Publications for NCOA2 Partial Recombinant Protein (H00010499-Q01)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for NCOA2 Partial Recombinant Protein (H00010499-Q01) (0)

There are no reviews for NCOA2 Partial Recombinant Protein (H00010499-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCOA2 Partial Recombinant Protein (H00010499-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional NCOA2 Products

Bioinformatics Tool for NCOA2 Partial Recombinant Protein (H00010499-Q01)

Discover related pathways, diseases and genes to NCOA2 Partial Recombinant Protein (H00010499-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA2 Partial Recombinant Protein (H00010499-Q01)

Discover more about diseases related to NCOA2 Partial Recombinant Protein (H00010499-Q01).
 

Pathways for NCOA2 Partial Recombinant Protein (H00010499-Q01)

View related products by pathway.

PTMs for NCOA2 Partial Recombinant Protein (H00010499-Q01)

Learn more about PTMs related to NCOA2 Partial Recombinant Protein (H00010499-Q01).
 

Research Areas for NCOA2 Partial Recombinant Protein (H00010499-Q01)

Find related products by research area.

Blogs on NCOA2

There are no specific blogs for NCOA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Amphiregulin [Biotin]
Amphiregulin [Biotin]
DY262
Immunocytochemistry/Immunofluorescence: NCOA2 Antibody [NB100-1756] - The majority of estradiol-induced PR-A or PR-B cells in the VMN of female mice coexpress SRC-1 and SRC-2. Representative images taken from estradiol-treated wt mice. Magnification: images, 400x; insets, 630x. Scale bar, 50um. Image collected and cropped by CiteAb from the following publication (eneuro.sfn.org/cgi/doi/10.1523/ENEURO.0012-15.2015), licensed under a CC-BY licence.
NCOA2 Antibody
NB100-1756
Western Blot: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of glucocorticoid receptor on mouse liver extract.
GR/NR3C1 Antibody (BuGR2)
NB300-731

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NCOA2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol NCOA2