NCAPH2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NCAPH2 Antibody [NBP2-49580] - Staining of human cell line MCF7 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NCAPH2 Antibody [NBP2-49580] - Staining in human bone marrow and pancreas tissues using anti-NCAPH2 antibody. Corresponding NCAPH2 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: NCAPH2 Antibody [NBP2-49580] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: NCAPH2 Antibody [NBP2-49580] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NCAPH2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFRMNTCVPHPRGAFMLEPEGMS
Specificity
Specificity of human NCAPH2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCAPH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NCAPH2 Recombinant Protein Antigen (NBP2-49580PEP)

Reactivity Notes

Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NCAPH2 Antibody

  • CAP-H2 subunit of the condensin II complex
  • CAP-H2
  • CAPH2,384D8-2
  • Chromosome-associated protein H2
  • condensin-2 complex subunit H2
  • hCAP-H2
  • kleisin beta
  • Kleisin-beta
  • MGC15858
  • MGC18000
  • MGC2455
  • MGC4133
  • MGC5305
  • MGC8640
  • Non-SMC condensin II complex subunit H2
  • non-SMC condensin II complex, subunit H2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010162-P01
Species: Hu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB3586
Species: Hu
Applications: WB, IP
H00006496-M04
Species: Hu
Applications: WB, ELISA
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-64650
Species: Hu, Mu, Rt, Po, GP, Ze
Applications: IHC, IHC-Fr, IHC-P
NBP1-90312
Species: Hu
Applications: IHC, IHC-P
AF7034
Species: Hu
Applications: WB
NB100-56630
Species: Hu
Applications: WB
NBP1-88345
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-61794
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-49580
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NCAPH2 Antibody (NBP2-49580) (0)

There are no publications for NCAPH2 Antibody (NBP2-49580).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCAPH2 Antibody (NBP2-49580) (0)

There are no reviews for NCAPH2 Antibody (NBP2-49580). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NCAPH2 Antibody (NBP2-49580) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NCAPH2 Antibody (NBP2-49580)

Discover related pathways, diseases and genes to NCAPH2 Antibody (NBP2-49580). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCAPH2 Antibody (NBP2-49580)

Discover more about diseases related to NCAPH2 Antibody (NBP2-49580).
 

Pathways for NCAPH2 Antibody (NBP2-49580)

View related products by pathway.

Blogs on NCAPH2

There are no specific blogs for NCAPH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCAPH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCAPH2