NAT8 Antibody - BSA Free

Western Blot: NAT8 Antibody [NBP2-87882] - Host: Rabbit. Target Name: NAT8. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NAT8 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human NAT8. Peptide sequence: KYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAT8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NAT8 Antibody - BSA Free

• Camello-like protein 1
• CML1
• EC 2.3.1
• EC 2.3.1.-
• GLAkidney- and liver-specific gene product
• Hcml1
• N-acetyltransferase 8 (GCN5-related, putative)
• N-acetyltransferase 8
• probable N-acetyltransferase 8
• TSC501N-acetyltransferase 8 (camello like)
• TSC510

Background

The NAT8 gene, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affect

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAT8