NAPRT1 Antibody

Images

 
Western Blot: NAPRT1 Antibody [H00093100-B01P] - Analysis of NAPRT1 expression in human liver.
Western Blot: NAPRT1 Antibody [H00093100-B01P] - Analysis of NAPRT1 expression in transfected 293T cell line by NAPRT1 polyclonal antibody. Lane 1: NAPRT1 transfected lysate(51.26 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NAPRT1 Antibody Summary

Immunogen
NAPRT1 (NP_660202, 1 a.a. - 466 a.a.) full-length human protein. MALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQVAAPPPSS
Specificity
NAPRT1 - nicotinate phosphoribosyltransferase domain containing 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NAPRT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NAPRT1 Antibody

  • EC 2.4.2.11
  • FHA-HIT-interacting protein
  • FHIP
  • NAPRTase
  • nicotinate phosphoribosyltransferase domain containing 1
  • Nicotinate phosphoribosyltransferase domain-containing protein 1
  • nicotinate phosphoribosyltransferase
  • nicotinic acid phosphoribosyltransferase
  • PP3856

Background

Nicotinic acid (NA; niacin) is converted by nicotinic acid phosphoribosyltransferase (NAPRT; EC 2.4.2.11) to NA mononucleotide (NaMN), which is then converted to NA adenine dinucleotide (NaAD), and finally to nicotinamide adenine dinucleotide (NAD), which serves as a coenzyme in cellular redox reactions and is an essential component of a variety of processes in cellular metabolism including response to stress (Hara et al., 2007).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-594
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1923
Species: Ce
Applications: IHC, IHC-P, IP, WB
AF1049
Species: Hu
Applications: IHC, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02860
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89519
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-86108
Species: Hu
Applications: IHC, IHC-P, WB
H00006999-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NBP2-49350
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
DNDG00
Species: Hu
Applications: ELISA
NBP2-67593
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50033
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB

Publications for NAPRT1 Antibody (H00093100-B01P) (0)

There are no publications for NAPRT1 Antibody (H00093100-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAPRT1 Antibody (H00093100-B01P) (0)

There are no reviews for NAPRT1 Antibody (H00093100-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAPRT1 Antibody (H00093100-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAPRT1 Products

Bioinformatics Tool for NAPRT1 Antibody (H00093100-B01P)

Discover related pathways, diseases and genes to NAPRT1 Antibody (H00093100-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAPRT1 Antibody (H00093100-B01P)

Discover more about diseases related to NAPRT1 Antibody (H00093100-B01P).
 

Pathways for NAPRT1 Antibody (H00093100-B01P)

View related products by pathway.

Blogs on NAPRT1

There are no specific blogs for NAPRT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAPRT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAPRT1
Entrez
Uniprot