NAP1L4 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of NAP1L4. Peptide sequence: HDLERKYAALYQPLFDKRREFITGDVEPTDAESAWHSENEEEDKLAGDMK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NAP1L4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for NAP1L4 Antibody - BSA Free
Background
NAP1L4 (Nucleosome Assembly Protein 1-Like 4) is thought to have involvement as a histone chaperone. Due to its location near the imprinted gene domain of 11p15.5, NAP1L4 has been studied in relation to Wilms tumor, Beckwith-Wiedemann syndrome, rhabdomyosarcoma and several forms of cancer including breast, lung and ovarian cancer. NAP1L4 is known to have interactions with HIST1H4A, HIST2H4A, HIST1H4AB, HIST1H4C and HIST1H4D.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: CyTOF-reported, Flow, IHC, Neut
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Ca, Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Publications for NAP1L4 Antibody (NBP2-86723) (0)
There are no publications for NAP1L4 Antibody (NBP2-86723).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NAP1L4 Antibody (NBP2-86723) (0)
There are no reviews for NAP1L4 Antibody (NBP2-86723).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NAP1L4 Antibody (NBP2-86723) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NAP1L4 Products
Research Areas for NAP1L4 Antibody (NBP2-86723)
Find related products by research area.
|
Blogs on NAP1L4