Recombinant Human Nanos3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Nanos3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 100 of Human NANOS3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGTFDLWTDYLGLAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNGESRAIYQSHVLKDEAG

Protein/Peptide Type
Partial Recombinant Protein
Gene
NANOS3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nanos3 Protein

  • MGC120114
  • nanos homolog 3 (Drosophila)
  • nanos homolog 3
  • NOS-3
  • NOS3NANOS1L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27084
Species: Hu, Pm
Applications: WB, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Nanos3 Partial Recombinant Protein (H00342977-Q01) (0)

There are no publications for Nanos3 Partial Recombinant Protein (H00342977-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nanos3 Partial Recombinant Protein (H00342977-Q01) (0)

There are no reviews for Nanos3 Partial Recombinant Protein (H00342977-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nanos3 Partial Recombinant Protein (H00342977-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nanos3 Products

Bioinformatics Tool for Nanos3 Partial Recombinant Protein (H00342977-Q01)

Discover related pathways, diseases and genes to Nanos3 Partial Recombinant Protein (H00342977-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nanos3 Partial Recombinant Protein (H00342977-Q01)

Discover more about diseases related to Nanos3 Partial Recombinant Protein (H00342977-Q01).
 

Pathways for Nanos3 Partial Recombinant Protein (H00342977-Q01)

View related products by pathway.

PTMs for Nanos3 Partial Recombinant Protein (H00342977-Q01)

Learn more about PTMs related to Nanos3 Partial Recombinant Protein (H00342977-Q01).

Blogs on Nanos3

There are no specific blogs for Nanos3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nanos3 Antibody
NBP1-76919

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nanos3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NANOS3