NAF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NAF1 Antibody [NBP1-90341] - Staining of human cell line U-2 OS shows positivity in cytoplasm, centrosome and cell junctions.
Immunohistochemistry-Paraffin: NAF1 Antibody [NBP1-90341] - Staining of human esophagus shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NAF1 Protein (NBP1-90341PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAF1 Antibody

  • nuclear assembly factor 1 homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-13656
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92388
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84423
Species: Hu
Applications: IHC, IHC-P
NBP2-31742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
MAB7675
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-59008
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90341
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for NAF1 Antibody (NBP1-90341) (0)

There are no publications for NAF1 Antibody (NBP1-90341).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAF1 Antibody (NBP1-90341) (0)

There are no reviews for NAF1 Antibody (NBP1-90341). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NAF1 Antibody (NBP1-90341) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAF1 Products

Bioinformatics Tool for NAF1 Antibody (NBP1-90341)

Discover related pathways, diseases and genes to NAF1 Antibody (NBP1-90341). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAF1 Antibody (NBP1-90341)

Discover more about diseases related to NAF1 Antibody (NBP1-90341).
 

Pathways for NAF1 Antibody (NBP1-90341)

View related products by pathway.

PTMs for NAF1 Antibody (NBP1-90341)

Learn more about PTMs related to NAF1 Antibody (NBP1-90341).

Blogs on NAF1

There are no specific blogs for NAF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAF1