Recombinant Human Nab2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Nab2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 241 of Human NAB2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSRWDWGWSRPTGARDGTPACLGRVWMDICRLWGHVQG

Protein/Peptide Type
Recombinant Protein
Gene
NAB2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nab2 Protein

  • EGR-1-binding protein 2
  • MADEREGR1 binding protein 2
  • Melanoma-associated delayed early response protein
  • MGC75085
  • NGFI-A binding protein 2 (EGR1 binding protein 2)
  • NGFI-A-binding protein 2
  • Protein MADER

Background

This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP1-86163
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80903
Species: Hu
Applications: IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00004665-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Nab2 Recombinant Protein (H00004665-P01) (0)

There are no publications for Nab2 Recombinant Protein (H00004665-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nab2 Recombinant Protein (H00004665-P01) (0)

There are no reviews for Nab2 Recombinant Protein (H00004665-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nab2 Recombinant Protein (H00004665-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nab2 Products

Bioinformatics Tool for Nab2 Recombinant Protein (H00004665-P01)

Discover related pathways, diseases and genes to Nab2 Recombinant Protein (H00004665-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nab2 Recombinant Protein (H00004665-P01)

Discover more about diseases related to Nab2 Recombinant Protein (H00004665-P01).
 

Pathways for Nab2 Recombinant Protein (H00004665-P01)

View related products by pathway.

PTMs for Nab2 Recombinant Protein (H00004665-P01)

Learn more about PTMs related to Nab2 Recombinant Protein (H00004665-P01).
 

Research Areas for Nab2 Recombinant Protein (H00004665-P01)

Find related products by research area.

Blogs on Nab2

There are no specific blogs for Nab2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
Nab2 Antibody
NBP2-19462

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nab2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NAB2