Recombinant Human Nab2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Nab2 Protein [H00004665-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Nab2 GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 241 of Human NAB2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSRWDWGWSRPTGARDGTPACLGRVWMDICRLWGHVQG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
NAB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
52.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nab2 GST (N-Term) Protein

  • EGR-1-binding protein 2
  • MADEREGR1 binding protein 2
  • Melanoma-associated delayed early response protein
  • MGC75085
  • NGFI-A binding protein 2 (EGR1 binding protein 2)
  • NGFI-A-binding protein 2
  • Protein MADER

Background

This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001958-M03
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71838
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IP
NBP2-82977
Species: Hu
Applications: WB, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-67358
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-57156
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
H00004665-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for Nab2 Recombinant Protein (H00004665-P01) (0)

There are no publications for Nab2 Recombinant Protein (H00004665-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nab2 Recombinant Protein (H00004665-P01) (0)

There are no reviews for Nab2 Recombinant Protein (H00004665-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nab2 Recombinant Protein (H00004665-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Nab2 Products

Bioinformatics Tool for Nab2 Recombinant Protein (H00004665-P01)

Discover related pathways, diseases and genes to Nab2 Recombinant Protein (H00004665-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nab2 Recombinant Protein (H00004665-P01)

Discover more about diseases related to Nab2 Recombinant Protein (H00004665-P01).
 

Pathways for Nab2 Recombinant Protein (H00004665-P01)

View related products by pathway.

PTMs for Nab2 Recombinant Protein (H00004665-P01)

Learn more about PTMs related to Nab2 Recombinant Protein (H00004665-P01).
 

Research Areas for Nab2 Recombinant Protein (H00004665-P01)

Find related products by research area.

Blogs on Nab2

There are no specific blogs for Nab2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nab2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NAB2