NAB1 Antibody

Images

 
Western Blot: NAB1 Antibody [NBP1-86163] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: NAB1 Antibody [NBP1-86163] - Staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & the Golgi apparatus.
Immunohistochemistry-Paraffin: NAB1 Antibody [NBP1-86163] - Staining of human lung shows strong membranous positivity in alveolar cells and distinct staining in vessel wall.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MIGHIFEMNDDDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQLCVKDNALLTRRDELFALARQISREVTYKYTYRTTKSKCGERDELSPKRIKVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NAB1 Protein (NBP1-86163PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAB1 Antibody

  • EGR1 binding protein 1
  • EGR-1-binding protein 1
  • NGFI-A binding protein 1 (EGR1 binding protein 1)
  • NGFI-A-binding protein 1
  • Transcriptional regulatory protein p54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBP2-19462
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80903
Species: Hu
Applications: IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00001846-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NAB1 Antibody (NBP1-86163) (0)

There are no publications for NAB1 Antibody (NBP1-86163).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAB1 Antibody (NBP1-86163) (0)

There are no reviews for NAB1 Antibody (NBP1-86163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NAB1 Antibody (NBP1-86163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NAB1 Products

Bioinformatics Tool for NAB1 Antibody (NBP1-86163)

Discover related pathways, diseases and genes to NAB1 Antibody (NBP1-86163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAB1 Antibody (NBP1-86163)

Discover more about diseases related to NAB1 Antibody (NBP1-86163).
 

Pathways for NAB1 Antibody (NBP1-86163)

View related products by pathway.

PTMs for NAB1 Antibody (NBP1-86163)

Learn more about PTMs related to NAB1 Antibody (NBP1-86163).

Blogs on NAB1

There are no specific blogs for NAB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAB1