Nab2 Antibody

Western Blot: Nab2 Antibody [H00004665-D01P] - Analysis of NAB2 expression in transfected 293T cell line by NAB2 polyclonal antibody.Lane 1: NAB2 transfected lysate(25.90 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

Nab2 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: NAB2 (AAH07756.1, 1 a.a. - 241 a.a.) full-length human protein. MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSRWDWGWSRPTGARDGTPACLGRVWMDICRLWGHVQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAB2
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: It has been used for WB and Functional.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nab2 Antibody

• EGR-1-binding protein 2
• MADEREGR1 binding protein 2
• Melanoma-associated delayed early response protein
• MGC75085
• NGFI-A binding protein 2 (EGR1 binding protein 2)
• NGFI-A-binding protein 2
• Protein MADER

Background

Transcriptional control is in part regulated by interactions between DNA-bound transcription factors, such as Egr-1/NGFI-A, and coregulatory proteins, such as NAB (for NGFI-A-binding proteins). The evolutionarily conserved NAB proteins, NAB1 and NAB2, are corepressors of EGF-1/NGFI-A. Both NAB1 and NAB2 contain an amino terminal NAB conserved domain 1 (NCB1), which is required for binding NGFI-A, and a carboxy terminal NCD2 domain, which is responsible for the repressor function of NAB proteins. NAB2 is principally localized in the nucleus and may play a role in the downregulation of NGFI-A activity as well as in controlling fundamental processes such as cell division, differentiation and apoptosis. NAB2 has a predicted molecular mass of 56 kDa and localizes to chromosome 12q13.3-14.1, a region that is rearranged in several solid tumors, lipomas and liposarcomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAB2