Nab2 Antibody

Western Blot: Nab2 Antibody [H00004665-B01P] - Analysis of NAB2 expression in transfected 293T cell line by NAB2 polyclonal antibody. Lane 1: NAB2 transfected lysate(26.51 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Nab2 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: NAB2 (AAH07756.1, 1 a.a. - 241 a.a.) full-length human protein. MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSRWDWGWSRPTGARDGTPACLGRVWMDICRLWGHVQG
• Specificity: NAB2 - NGFI-A binding protein 2 (EGR1 binding protein 2),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: NAB2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nab2 Antibody

• EGR-1-binding protein 2
• MADEREGR1 binding protein 2
• Melanoma-associated delayed early response protein
• MGC75085
• NGFI-A binding protein 2 (EGR1 binding protein 2)
• NGFI-A-binding protein 2
• Protein MADER

Background

This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAB2
• Entrez:
  • 4665(Human)