N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody [NBP2-13645] - Staining of human cell line PC-3 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody [NBP2-13645] - Staining of human stomach (lower) shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YYSTHLQRWLTYYPSGQLLIVDGQELRTNPAASMESIQKFLGITPFLNYT RTLRFDDDKGF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDST2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
N-Deacetylase/N-Sulfotransferase 2/NDST2 Protein (NBP2-13645PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody

  • bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2
  • EC 2.8.2.8
  • Glucosaminyl N-deacetylase/N-sulfotransferase 2
  • HSST2MGC129697
  • MGC129705
  • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 2
  • NDST2
  • NDST-2
  • N-heparan sulfate sulfotransferase 2
  • N-HSST 2
  • NST2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-49216
Species: Hu
Applications: ICC/IF, IHC
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86481
Species: Hu
Applications: IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB300-157
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00027044-P01
Species: Hu
NB100-56498
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30481
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80886
Species: Hu
Applications: WB, IHC, IHC-P
AF5968
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645) (0)

There are no publications for N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645) (0)

There are no reviews for N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-Deacetylase/N-Sulfotransferase 2/NDST2 Products

Bioinformatics Tool for N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645)

Discover related pathways, diseases and genes to N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645)

Discover more about diseases related to N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645).
 

Pathways for N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645)

View related products by pathway.

PTMs for N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645)

Learn more about PTMs related to N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody (NBP2-13645).

Blogs on N-Deacetylase/N-Sulfotransferase 2/NDST2

There are no specific blogs for N-Deacetylase/N-Sulfotransferase 2/NDST2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDST2
Entrez