NDST4 Antibody - BSA Free

Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.

Staining of human lymph node show no positivity in germinal center cells as expected.

Staining of human pancreas shows moderate cytoplasmic positivity in interlobular ducts.

Staining of human duodenum shows moderate membranous positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDST4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GYKQEMTLIETTAEAECTDIKILPYRSMELKTVKPIDTSKTDPTVLLFVESQYSQLGQDIIAILESSRFQ
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDST4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NDST4 Protein (NBP1-86481PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NDST4 Antibody - BSA Free

• bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4
• EC 2.8.2.8
• Glucosaminyl N-deacetylase/N-sulfotransferase 4
• HSST4
• N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4
• NDST-4
• N-heparan sulfate sulfotransferase 4
• N-HSST 4
• NHSST4

Background

Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine(GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backboneto make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Has lowdeacetylase activity but high sulfotransferase activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDST4