NDST4 Antibody

Images

 
Immunohistochemistry: NDST4 Antibody [NBP1-86481] - Staining of human pancreas shows distinct cytoplasmic positivity in interlobular ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDST4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GYKQEMTLIETTAEAECTDIKILPYRSMELKTVKPIDTSKTDPTVLLFVESQYSQLGQDIIAILESSRFQ
Specificity
Specificity of human NDST4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDST4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDST4 Protein (NBP1-86481PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDST4 Antibody

  • bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4
  • EC 2.8.2.8
  • Glucosaminyl N-deacetylase/N-sulfotransferase 4
  • HSST4
  • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4
  • NDST-4
  • N-heparan sulfate sulfotransferase 4
  • N-HSST 4
  • NHSST4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP2-13645
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6174
Species: Hu
Applications: WB, IHC, IP
NBP2-49216
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-01819
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-19676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86481
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for NDST4 Antibody (NBP1-86481) (0)

There are no publications for NDST4 Antibody (NBP1-86481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDST4 Antibody (NBP1-86481) (0)

There are no reviews for NDST4 Antibody (NBP1-86481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NDST4 Antibody (NBP1-86481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NDST4 Antibody (NBP1-86481)

Discover related pathways, diseases and genes to NDST4 Antibody (NBP1-86481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDST4 Antibody (NBP1-86481)

Discover more about diseases related to NDST4 Antibody (NBP1-86481).
 

Pathways for NDST4 Antibody (NBP1-86481)

View related products by pathway.

PTMs for NDST4 Antibody (NBP1-86481)

Learn more about PTMs related to NDST4 Antibody (NBP1-86481).

Blogs on NDST4

There are no specific blogs for NDST4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDST4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDST4