N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free

Western Blot: N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free [NBP2-94188] - Western blot analysis of extracts of various cell lines, using N-Acetylglucosaminyltransferase V/MGAT5 Rabbit pAb antibody (A10567) at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.

Western Blot: N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free [NBP2-94188] - Western blot analysis of extracts of various cell lines, using N-Acetylglucosaminyltransferase V/MGAT5 Rabbit pAb antibody (A10567) at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 627-741 of human N-Acetylglucosaminyltransferase V/MGAT5 (NP_002401.1). HGQVMWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MGAT5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Western Blot 1:100 - 1:500
• Theoretical MW: 85 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for N-Acetylglucosaminyltransferase V/MGAT5 Antibody - Azide and BSA Free

• alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
• Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase
• EC 2.4.1.155
• GGNT5
• GlcNAc-T V
• GNT-VGNT-VA
• Mannoside acetylglucosaminyltransferase 5
• mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase
• MGAT5
• N-Acetylglucosaminyltransferase V
• N-acetylglucosaminyl-transferase V

Background

MGAT5 - mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MGAT5