N-Acetylglucosaminyltransferase V/MGAT5 Antibody

Images

 
Immunohistochemistry-Paraffin: N-Acetylglucosaminyltransferase V/MGAT5 Antibody [NBP1-83354] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

N-Acetylglucosaminyltransferase V/MGAT5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MGAT5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
N-Acetylglucosaminyltransferase V/MGAT5 Protein (NBP1-83354PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for N-Acetylglucosaminyltransferase V/MGAT5 Antibody

  • alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
  • Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase
  • EC 2.4.1.155
  • GGNT5
  • GlcNAc-T V
  • GNT-VGNT-VA
  • Mannoside acetylglucosaminyltransferase 5
  • mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase
  • MGAT5
  • N-Acetylglucosaminyltransferase V
  • N-acetylglucosaminyl-transferase V

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58992
Species: Hu
Applications: ICC/IF
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-83354
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354) (0)

There are no publications for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354) (0)

There are no reviews for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-Acetylglucosaminyltransferase V/MGAT5 Products

Bioinformatics Tool for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354)

Discover related pathways, diseases and genes to N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354)

Discover more about diseases related to N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354).
 

Pathways for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354)

View related products by pathway.

PTMs for N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354)

Learn more about PTMs related to N-Acetylglucosaminyltransferase V/MGAT5 Antibody (NBP1-83354).

Blogs on N-Acetylglucosaminyltransferase V/MGAT5

There are no specific blogs for N-Acetylglucosaminyltransferase V/MGAT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-Acetylglucosaminyltransferase V/MGAT5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MGAT5
Entrez