N-Acetylglucosaminyltransferase III/MGAT3 Antibody (4R7E2)

Western Blot: N-Acetylglucosaminyltransferase III/MGAT3 Antibody (4R7E2) [NBP3-33478] - Western blot analysis of various lysates using N-Acetylglucosaminyltransferase III/MGAT3 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Negative control (NC): mouse skeletal muscle.Exposure time: 45s.

• Reactivity: Mu
• Applications: WB, ELISA
• Clone: 4R7E2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

N-Acetylglucosaminyltransferase III/MGAT3 Antibody (4R7E2) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 381-480 of human N-Acetylglucosaminyltransferase III/MGAT3 (NP_002400.3).
  
  Sequence:
  LRRRQYYTMPNFRQYENRTGHILVQWSLGSPLHFAGWHCSWCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEH
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MGAT3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for N-Acetylglucosaminyltransferase III/MGAT3 Antibody (4R7E2)

• beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
• EC 2.4.1.144
• FLJ43371
• GGNT3
• GlcNAc-T III
• GNT3
• GNT-III
• GNT-IIIMGC142278
• mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
• MGAT3
• MGC141943
• N-acetylglucosaminyltransferase III
• N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III

Background

There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. The enzyme encoded by this gene transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MGAT3