Myotilin Antibody - BSA Free

Staining of human skeletal muscle shows high expression.

Analysis in human skeletal muscle and skin tissues.

Staining of human skin shows low expression as expected.

Staining of human testis.

Staining of human lymph node.

Staining of human skeletal muscle shows high expression.

Staining of human cerebral cortex.

Staining of human cerebral cortex, lymph node, skeletal muscle and testis HPA037733 (A) shows similar protein distribution across tissues to independent antibody HPA037734 (B).

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Myotilin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSSSAFPASPQQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNYQQSSAGQPINAKPSQTANAKPIPRTPDHEIQG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYOT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Myotilin Protein (NBP1-87851PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Myotilin Antibody - BSA Free

• 57 kDa cytoskeletal protein
• LGMD1A
• limb-girdle muscular dystrophy 1A (autosomal dominant)
• Myofibrillar titin-like Ig domains protein
• myotilin
• titin immunoglobulin domain protein (myotilin)
• Titin immunoglobulin domain protein
• TTIDLGMD1

Background

Striated muscle sarcomeres are highly organized structures composed of actin (thin) and myosin (thick) filaments that slide past each other during contraction. The integrity of sarcomeres is controlled by a set of structural proteins, among which are titin (TTN; MIM 188840), a giant molecule that contains several immunoglobulin (Ig)-like domains and associates with thin and thick filaments, and alpha-actinin (ACTN1; MIM 102575), an actin cross-linking protein. Mutations in several sarcomeric and sarcolemmal proteins have been shown to result in muscular dystrophy and cardiomyopathy.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYOT