Myotilin Antibody

Images

 
Western Blot: Myotilin Antibody [NBP1-87851] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: Myotilin Antibody [NBP1-87851] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myotilin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSSSAFPASPQQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNYQQSSAGQPINAKPSQTANAKPIPRTPDHEIQG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYOT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Myotilin Protein (NBP1-87851PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myotilin Antibody

  • 57 kDa cytoskeletal protein
  • LGMD1A
  • limb-girdle muscular dystrophy 1A (autosomal dominant)
  • Myofibrillar titin-like Ig domains protein
  • myotilin
  • titin immunoglobulin domain protein (myotilin)
  • Titin immunoglobulin domain protein
  • TTIDLGMD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85439
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-15109
Species: Hu
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89300
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00084665-M04
Species: Hu
Applications: WB, ELISA
NBP2-27398
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-80952
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-87851
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Myotilin Antibody (NBP1-87851) (0)

There are no publications for Myotilin Antibody (NBP1-87851).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myotilin Antibody (NBP1-87851) (0)

There are no reviews for Myotilin Antibody (NBP1-87851). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myotilin Antibody (NBP1-87851) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myotilin Products

Bioinformatics Tool for Myotilin Antibody (NBP1-87851)

Discover related pathways, diseases and genes to Myotilin Antibody (NBP1-87851). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myotilin Antibody (NBP1-87851)

Discover more about diseases related to Myotilin Antibody (NBP1-87851).
 

Pathways for Myotilin Antibody (NBP1-87851)

View related products by pathway.

PTMs for Myotilin Antibody (NBP1-87851)

Learn more about PTMs related to Myotilin Antibody (NBP1-87851).

Blogs on Myotilin

There are no specific blogs for Myotilin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myotilin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYOT