Myozenin 1 Antibody

Images

 
Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human testis.
Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human heart muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human skeletal muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining in human skeletal muscle and heart muscle tissues using anti-MYOZ1 antibody. Corresponding MYOZ1 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human cerebral cortex, liver, skeletal muscle and testis using Anti-MYOZ1 antibody NBP1-85439 (A) shows ...read more
Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Myozenin 1 Antibody [NBP1-85439] - Staining of human liver.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myozenin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QHHLGSGSGAGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYOZ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot
Application Notes
Use in Western Blot reported in scientific literature (PMID:28369518).For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Myozenin 1 Protein (NBP1-85439PEP)
Publications
Read Publication using
NBP1-85439 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%) Use in Mouse reported in scientific literature (PMID:28369518).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myozenin 1 Antibody

  • calsarcin-2
  • CS-2
  • FATZ
  • Filamin-, actinin- and telethonin-binding protein
  • MYOZ
  • myozenin 1
  • myozenin
  • myozenin-1
  • Protein FATZ

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88259
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00011155-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, KD, WB
NBP2-38361
Species: Hu
Applications: IHC, IHC-P
NBP2-15128
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-46376
Species: Hu
Applications: IHC, WB
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
NBP1-85544
Species: Hu
Applications: IHC, IHC-P, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
AF5366
Species: Hu, Mu, Rt
Applications: Simple Western, WB
DPI00
Species: Hu
Applications: ELISA
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB

Publications for Myozenin 1 Antibody (NBP1-85439)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Myozenin 1 Antibody (NBP1-85439) (0)

There are no reviews for Myozenin 1 Antibody (NBP1-85439). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myozenin 1 Antibody (NBP1-85439) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Myozenin 1 Products

Bioinformatics Tool for Myozenin 1 Antibody (NBP1-85439)

Discover related pathways, diseases and genes to Myozenin 1 Antibody (NBP1-85439). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myozenin 1 Antibody (NBP1-85439)

Discover more about diseases related to Myozenin 1 Antibody (NBP1-85439).
 

Pathways for Myozenin 1 Antibody (NBP1-85439)

View related products by pathway.

PTMs for Myozenin 1 Antibody (NBP1-85439)

Learn more about PTMs related to Myozenin 1 Antibody (NBP1-85439).

Blogs on Myozenin 1

There are no specific blogs for Myozenin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myozenin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYOZ1