Myosin light chain 3 Antibody - BSA Free

Western Blot: Myosin light chain 3 Antibody [NBP2-57186] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunohistochemistry-Paraffin: Myosin light chain 3 Antibody [NBP2-57186] - Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Myosin light chain 3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Myosin light chain 3 Recombinant Protein Antigen (NBP2-57186PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Myosin light chain 3 Antibody - BSA Free

• Cardiac myosin light chain 1
• CMH8Ventricular/slow twitch myosin alkali light chain
• CMLC1
• light polypeptide 3, alkali; ventricular, skeletal, slow
• MLC1SBMyosin light chain 1, slow-twitch muscle B/ventricular isoform
• MLC1V
• myosin light chain 3
• myosin, light chain 3, alkali; ventricular, skeletal, slow
• VLC1

Background

Myosin light chain 3, or MYL3 for short, consists of a 195 amino acid isoform that is 22 kDa, and is involved in the regulation of Myosin, which is a protein that conducts ATP hydrolysis. Current research is being conducted on the relationship between Myosin light chain 3 and a multitude of diseases and disorders, including familial hypertrophic cardiomyopathy, congestive heart failure, restrictive cardiomyopathy, dilated cardiomyopathy, diabetes mellitus, and renal failure. Myosin light chain 3 has been linked to the RhoA pathway, as well as PKA signaling, growth cone motility, cell adhesion, cardiac muscle contraction, and cytoskeleton remodeling. The protein interacts with YWHAQ, MYH13, YWHAZ, MYH9, and MYH7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Myosin light chain 3 Antibody (NBP2-57186)(1)

Publication using NBP2-57186

• Muir CA, Bork BS, Neff BD, Damjanovski S Proteomic analysis of temperature-dependent developmental plasticity within the ventricle of juvenile Atlantic salmon (Salmo salar) Current research in physiology 2022-08-10 [PMID: 36035983] (WB, Fish)

Bioinformatics

• Gene Symbol: MYL3