Recombinant Human Myosin Heavy Chain 3 GST (N-Term) Protein

SDS-Page: Recombinant Human heavy chain Myosin Protein [H00004621-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human Myosin Heavy Chain 3 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2-100 of Human heavy chain Myosin
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: SSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEP

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: MYH3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Myosin Heavy Chain 3 GST (N-Term) Protein

• HEMHC
• Muscle embryonic myosin heavy chain
• MYH3
• MYHC-EMB
• MYHSE1
• Myosin Heavy Chain 3
• Myosin heavy chain, fast skeletal muscle, embryonic
• myosin, heavy chain 3, skeletal muscle, embryonic
• myosin, heavy polypeptide 3, skeletal muscle, embryonic
• myosin, skeletal, heavy chain, embryonic 1
• myosin-3
• SMHCE
• SMHCEMyosin heavy chain 3

Background

Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. This gene is a member of the MYH family and encodes a protein with an IQ domain and a myosin head-like domain. Mutations in this gene have been associated with two congenital contracture (arthrogryposis) syndromes, Freeman-Sheldon syndrome and Sheldon-Hall syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Myosin Heavy Chain 3 Partial Recombinant Protein (H00004621-Q01)(1)

Publication using H00004621-Q01

• Nunes DF, Guedes PM, de Mesquita Andrade C et al. Troponin T autoantibodies correlate with chronic cardiomyopathy in Human Chagas disease. Trop Med Int Health 2013-08-01 [PMID: 23906320] (ELISA)

Bioinformatics

• Gene Symbol: MYH3