Myosin heavy chain 15 Antibody

Immunohistochemistry-Paraffin: Myosin heavy chain 15 Antibody [NBP1-87894] - Staining of human caudate shows moderate positivity in astrocytes.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Myosin heavy chain 15 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KMERERADLTQDLADLNERLEEVGGSSLAQLEITKKQETKFQKLHRDMEEATLHFETTSASLKKRH
• Marker: Slow Myosin, Heavy Chain Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYH15
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Myosin heavy chain 15 Protein (NBP1-87894PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Myosin heavy chain 15 Antibody

• MYH15 myosin, heavy chain 15
• myosin-15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYH15