Recombinant Human Ly-6G5B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Ly-6G5B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-201 of Human LY6G5B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
LY6G5B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ly-6G5B Protein

  • C6orf19
  • chromosome 6 open reading frame 19
  • G5b
  • lymphocyte antigen 6 complex locus protein G5b
  • lymphocyte antigen 6 complex, locus G5B
  • lymphocyte antigen-6 G5B

Background

LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

1849-NK
Species: Hu
MAB9350
Species: Hu
Applications: WB, IHC, IHC-P
8457-AS
Species: Hu
NB100-62239
Species: Hu
Applications: ELISA, IHC-P, RIA
NBP2-30732
Species: Hu
Applications: IHC, IHC-P
NBP2-24505
Species: Hu, Pm
Applications: WB
NB600-1387
Species: Hu, Mu
Applications: Flow, Func, IA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87894
Species: Hu
Applications: IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5245
Species: Hu, Mu, Rt
Applications: WB, IHC
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP2-12139
Species: Mu
Applications: Flow, IHC, IHC-P, CyTOF-ready
NBP1-98474
Species: Hu
Applications: WB
NBP2-56533
Species: Hu
Applications: ICC/IF
H00003851-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for Ly-6G5B Recombinant Protein (H00058496-P01) (0)

There are no publications for Ly-6G5B Recombinant Protein (H00058496-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ly-6G5B Recombinant Protein (H00058496-P01) (0)

There are no reviews for Ly-6G5B Recombinant Protein (H00058496-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ly-6G5B Recombinant Protein (H00058496-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ly-6G5B Products

Bioinformatics Tool for Ly-6G5B Recombinant Protein (H00058496-P01)

Discover related pathways, diseases and genes to Ly-6G5B Recombinant Protein (H00058496-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ly-6G5B Recombinant Protein (H00058496-P01)

Discover more about diseases related to Ly-6G5B Recombinant Protein (H00058496-P01).
 

Pathways for Ly-6G5B Recombinant Protein (H00058496-P01)

View related products by pathway.

Research Areas for Ly-6G5B Recombinant Protein (H00058496-P01)

Find related products by research area.

Blogs on Ly-6G5B

There are no specific blogs for Ly-6G5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Ly-6G5B Antibody
NBP2-14208
BMAL1 Antibody
NB100-2288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ly-6G5B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LY6G5B