Recombinant Human Ly-6G5B GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Ly-6G5B GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-201 of Human LY6G5B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
LY6G5B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ly-6G5B GST (N-Term) Protein

  • C6orf19
  • chromosome 6 open reading frame 19
  • G5b
  • lymphocyte antigen 6 complex locus protein G5b
  • lymphocyte antigen 6 complex, locus G5B
  • lymphocyte antigen-6 G5B

Background

LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1849-NK
Species: Hu
Applications: BA
MAB9350
Species: Hu
Applications: IHC, IHC-P, WB
8457-AS
Species: Hu
Applications: EnzAct
NB100-62239
Species: Hu
Applications: ELISA, IHC, IHC-P, RIA
NBP2-53131
Species: Mu
Applications: Flow
5499-G6
Species: Hu
Applications: Bind
NBP2-06220
Species: Hu
Applications: WB
NBP1-87894
Species: Hu
Applications: IHC, IHC-P
NB100-2288
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF5245
Species: Hu, Mu, Rt
Applications: IHC, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB7089
Species: Mu
Applications: CyTOF-ready, Flow, IHC
NBP1-97564
Species: Hu, Pm
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-Fr, IP, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
H00001130-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-67706
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Ly-6G5B Recombinant Protein (H00058496-P01) (0)

There are no publications for Ly-6G5B Recombinant Protein (H00058496-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ly-6G5B Recombinant Protein (H00058496-P01) (0)

There are no reviews for Ly-6G5B Recombinant Protein (H00058496-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ly-6G5B Recombinant Protein (H00058496-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ly-6G5B Products

Bioinformatics Tool for Ly-6G5B Recombinant Protein (H00058496-P01)

Discover related pathways, diseases and genes to Ly-6G5B Recombinant Protein (H00058496-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ly-6G5B Recombinant Protein (H00058496-P01)

Discover more about diseases related to Ly-6G5B Recombinant Protein (H00058496-P01).
 

Pathways for Ly-6G5B Recombinant Protein (H00058496-P01)

View related products by pathway.

Research Areas for Ly-6G5B Recombinant Protein (H00058496-P01)

Find related products by research area.

Blogs on Ly-6G5B

There are no specific blogs for Ly-6G5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMAL1 Antibody
NB100-2288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ly-6G5B GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LY6G5B