MYL9 Antibody


Western Blot: MYL9 Antibody [NBP1-55383] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB

Order Details

MYL9 Antibody Summary

Synthetic peptides corresponding to MYL9 (myosin, light chain 9, regulatory). The peptide sequence was selected from the middle region of MYL9. Peptide sequence FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MYL9 and was validated on Western blot.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using
NBP1-55383 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31066574).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MYL9 Antibody

  • LC2020 kDa myosin light chain
  • MLC2Myosin RLC
  • myosin regulatory light chain 1
  • Myosin regulatory light chain 2, smooth muscle isoform
  • Myosin regulatory light chain 9
  • Myosin regulatory light chain MRLC1
  • myosin regulatory light polypeptide 9
  • myosin, light chain 9, regulatory
  • myosin, light polypeptide 9, regulatory
  • MYRL2MGC3505


Myosin, a structural component of muscle, consists of two heavy chains and four light chains. MYL9 is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. It binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: All-Multi
Applications: ICC, IHC, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB

Publications for MYL9 Antibody (NBP1-55383)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for MYL9 Antibody (NBP1-55383) (0)

There are no reviews for MYL9 Antibody (NBP1-55383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYL9 Antibody (NBP1-55383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MYL9 Products

Bioinformatics Tool for MYL9 Antibody (NBP1-55383)

Discover related pathways, diseases and genes to MYL9 Antibody (NBP1-55383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYL9 Antibody (NBP1-55383)

Discover more about diseases related to MYL9 Antibody (NBP1-55383).

Pathways for MYL9 Antibody (NBP1-55383)

View related products by pathway.

PTMs for MYL9 Antibody (NBP1-55383)

Learn more about PTMs related to MYL9 Antibody (NBP1-55383).

Blogs on MYL9

There are no specific blogs for MYL9, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MYL9 Antibody and receive a gift card or discount.


Gene Symbol MYL9