Home » MYL9 » MYL9 Antibodies » MYL9 Antibody

MYL9 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: MYL9 Antibody [NBP1-55383] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: MYL9 Antibody [NBP1-55383] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Gt, Rb, Sh, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MYL9 Antibody Summary

Immunogen
Synthetic peptides corresponding to MYL9 (myosin, light chain 9, regulatory). The peptide sequence was selected from the middle region of MYL9. Peptide sequence FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYL9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MYL9 and was validated on Western blot.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
MYL9 Knockout HeLa Cell Lysate
Publications
Read Publication using
NBP1-55383 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MYL9 Antibody

  • LC2020 kDa myosin light chain
  • MLC2Myosin RLC
  • MRLC1MLC-2C
  • myosin regulatory light chain 1
  • Myosin regulatory light chain 2, smooth muscle isoform
  • Myosin regulatory light chain 9
  • Myosin regulatory light chain MRLC1
  • myosin regulatory light polypeptide 9
  • myosin, light chain 9, regulatory
  • myosin, light polypeptide 9, regulatory
  • MYRL2MGC3505

Background

Myosin, a structural component of muscle, consists of two heavy chains and four light chains. MYL9 is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. It binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myosin Light Chain
2 Antibody (3B2)
NBP1-30249
Western Blot: Myosin Light Chain 2 Antibody (3B2) [NBP1-30249] - The tissue lysate (40ug) was resolved by SDS-PAGE, transferred to PVDF membrane and probed with anti-human MYL2 antibody (1:1000). Proteins were visualized using a goat anti-mouse secondary antibody conjugated to HRP and an ECL detection system.Lane 1.: Mouse heart tissue lysate
Immunocytochemistry/Immunofluorescence: Myosin Light Chain 2 Antibody (3B2) [NBP1-30249] - Analysis of MYL2 in A431 cells. The cell was stained at (1:100). The secondary antibody (green) was used Alexa Fluor 488. DAPI was stained the cell nucleus (blue).
Flow Cytometry: Myosin Light Chain 2 Antibody (3B2) [NBP1-30249] - Analysis of MYL2 in A431 cells. The cell was stained at 2-5ug for 1x10^6cells (red). A Goat anti mouse IgG (Alexa fluor 488) was used as the secondary antibody. Mouse monoclonal IgG was used as the isotype control (dark gray), cells without incubation with primary and secondary antibody was used as the negative control (light gray).
(1 Review)
(4 Publications)
Species: Hu, Mu, Xp
Applications: WB, ELISA, Flow, ICC/IF, IHC
Fast skeletal
myosin light chain 2 ...
NBP2-62625
Immunohistochemistry-Paraffin: Fast skeletal myosin light chain 2 Antibody [NBP2-62625] - Staining of human skeletal muscle shows high expression.
Immunohistochemistry-Paraffin: Fast skeletal myosin light chain 2 Antibody [NBP2-62625] - Immunohistochemistry analysis in human skeletal muscle and duodenum tissues using Anti-MYLPF antibody. Corresponding MYLPF RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Fast skeletal myosin light chain 2 Antibody [NBP2-62625] - Staining of human duodenum shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
MLC1 Antibody
NBP1-81555
Western Blot: MLC1 Antibody [NBP1-81555] - Analysis in control (vector only transfected HEK293T lysate) and MLC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining in human cerebral cortex and pancreas tissues using anti-MLC1 antibody. Corresponding MLC1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebral cortex shows high expression.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Myosin light chain
kinase Antibody (SU40 ...
NBP2-67486
Western Blot: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Analysis of MYLK on human lung lysates using anti-MYLK antibody at 1/5,000 dilution.
Immunocytochemistry/Immunofluorescence: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Staining MYLK in L6 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Myosin light chain kinase Antibody (SU40-06) [NBP2-67486] - Analysis of paraffin-embedded rat smooth muscle tissue using anti-MYLK antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MYLK3 Antibody
NBP2-62682
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Analysis in human heart muscle and pancreas tissues using Anti-MYLK3 antibody. Corresponding MYLK3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MYLK3 Antibody [NBP2-62682] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
MYLK2 Antibody
(2G1)
H00085366-M01
Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - The antibody was tested in mouse skeletal muscle and shows a band below 75 kDa. This image was submitted via customer Review. *{Mouse WB}*
Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - Analysis of MYLK2 over-expressed 293 cell line, cotransfected with MYLK2 Validated Chimera RNAi ( Cat # H00085366-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYLK2 monoclonal antibody (M01), clone 2G1 (Cat # H00085366-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - Analysis of MYLK2 expression in transfected 293T cell line by MYLK2 monoclonal antibody (M01), clone 2G1.Lane 1: MYLK2 transfected lysate(64.7 KDa).Lane 2: Non-transfected lysate.
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, RNAi
Myosin Phosphatase
Antibody
NB110-38889
Western Blot: Myosin Phosphatase Antibody [NB110-38889] - Detection of human MYPT1 by western blot and immunoprecipitation. Samples: Whole cell lysate from HeLa (15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded), HEK293T (T; 50 ug) and Jurkat (J; 50 ug) cells. Antibodies: Affinity purified rabbit anti-MYPT1 antibody NB110-38889 (lot NB110-38889-2) used for WB at 0.4 ug/ml (A) and 1 ug/ml (B) and used for IP at 6 ug/mg lysate (B). MYPT1 was also immunoprecipitated by a previous lot (lot NB110-38889-1) of this antibody and by another rabbit anti-MYPT1 antibody, which recognizes a downstream epitope. Detection: Chemiluminescence with exposure times of 3 minutes (A) and 30 seconds (B).
Western Blot: Myosin Phosphatase Antibody [NB110-38889] - Whole cell lysate (1 mg/IP, 20% IP loaded) from HeLa cells. NB110-38889 used for IP (3 ug/mg lysate). MYPT1 was also immunoprecipitated by other MYPT1 antibody, recognize downstream epitopes.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, IP
Calmodulin 2
Antibody
NBP2-14871
Western Blot: Calmodulin 2 Antibody [NBP2-14871] - Sample (50 ug of whole cell lysate) A: Mouse brain 15% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Calmodulin 2 Antibody [NBP2-14871] - DIV9 rat E18 primary cortical neuron cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calmodulin 2 stained by Calmodulin 2 antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Calmodulin
Antibody (2D1)
NB120-2860
Western Blot: Calmodulin Antibody (2D1) [NB120-2860] - Purified Calmodulin using NB120-2860 and NB120-5494.
Immunocytochemistry/Immunofluorescence: Calmodulin Antibody (2D1) [NB120-2860] - Staining of rat brain.
Immunohistochemistry-Paraffin: Calmodulin Antibody (2D1) [NB120-2860] - Normal biopsies of deparaffinized Rat testis tissue.
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Calmodulin 3
Antibody
NBP1-98474
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human Jurkat, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Titration: 1.0 ug/ml Positive Control: Hela Whole Cell.
Western Blot: Calmodulin 3 Antibody [NBP1-98474] - Human 721_B, Antibody Dilution: 1.0 ug/ml CALM3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.
Species: Hu, Rt, Po
Applications: WB
RhoD Antibody
NBP1-58359
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Expos
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
Rhodopsin Antibody
(1D4)
NBP1-47602
Western Blot: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis of Human Cell lysates showing detection of Rhodopsin protein using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Dull epidermal staining.
(1 Publication)
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Myosin Heavy Chain was detected in immersion fixed C2C12 mouse myoblast cell line using Mouse Anti-Human Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Myosin Heavy Chain was detected in immersion fixed paraffin-embedded sections of human skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myosin Heavy Chain was detected in perfusion fixed frozen sections of mouse skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(3 Reviews)
(40 Publications)
Species: Multi
Applications: WB, IHC, ICC
MHC Class I
Antibody (OX18)
NB120-6405
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: MHC Class I Antibody (OX18) [NB120-6405] - Analysis of FFPE rat brain cerebellum using MHC Class I (OK18) antibody at 1:200 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Endothelial staining was observed. Staining was performed by Histowiz.
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).
(29 Publications)
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
MYL4 Antibody
NBP2-30954
Western Blot: MYL4 Antibody [NBP2-30954] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HEL
Immunocytochemistry/Immunofluorescence: MYL4 Antibody [NBP2-30954] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MYL4 Antibody [NBP2-30954] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MRLC2 Antibody
NBP2-54719
Western Blot: MRCL3 Antibody [NBP2-54719] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: MRLC2 Antibody [NBP2-54719] - MRCL3 Antibody [NBP2-54719] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: MRCL3 Antibody [NBP2-54719] - Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PRRT2 Antibody
NBP1-84168
Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human cerebellum shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human pancreas shows no positivity as expected.
Species: Hu
Applications: IHC, IHC-P
Serum Response
Factor SRF Antibody
NBP1-33063
Western Blot: Serum Response Factor SRF Antibody [NBP1-33063] - Sample (30 ug of whole cell lysate) A: Molt-4 10% SDS PAGE, antibody diluted at 1:500.
Immunocytochemistry/Immunofluorescence: Serum Response Factor SRF Antibody [NBP1-33063] - Paraformaldehyde-fixed A431, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Serum Response Factor SRF Antibody [NBP1-33063] - Mouse lung SRF dilution: 1:500. Antigen Retrieval: TrilogyTM (EDTA based) buffer, 15min
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
RhoA Antibody
NB100-91273
Western Blot: RhoA Antibody [NB100-91273] - Rat spinal cord lysate using Rabbit antibody to Transforming protein RhoA: whole serum at 1:2000 dilution. One single band is detected.
Immunocytochemistry/Immunofluorescence: RhoA Antibody [NB100-91273] - Rat trigeminal at 1:500 dilution using Rabbit antibody to Transforming protein RhoA: whole serum (NB100-91273, in red), Sheep antibody to extracellular, N-terminal part of Sortilin: whole serum (NB100-98771, in green), DAPI counter stained appearing in blue.
Immunohistochemistry: RhoA Antibody [NB100-91273] - IHC on rat brain (paraffin sections) using Rabbit antibody to RhoA at a concentration of 15 ug/ml, incubated overnight and developed with DAB Ni.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CPI17 alpha
Antibody
NBP2-37897
Western Blot: CPI17 alpha Antibody [NBP2-37897] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line A-549
Immunohistochemistry-Paraffin: CPI17 alpha Antibody [NBP2-37897] - Staining in human cerebral cortex and skin tissues using anti-PPP1R14A antibody. Corresponding PPP1R14A RNA-seq data are presented for the same tissues.
Immunohistochemistry: CPI17 alpha Antibody [NBP2-37897] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for MYL9 Antibody (NBP1-55383)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MYL9 Antibody (NBP1-55383) (0)

There are no reviews for MYL9 Antibody (NBP1-55383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYL9 Antibody (NBP1-55383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

MYL9 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional MYL9 Products

Bioinformatics Tool for MYL9 Antibody (NBP1-55383)

Discover related pathways, diseases and genes to MYL9 Antibody (NBP1-55383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYL9 Antibody (NBP1-55383)

Discover more about diseases related to MYL9 Antibody (NBP1-55383).
 

Pathways for MYL9 Antibody (NBP1-55383)

View related products by pathway.

PTMs for MYL9 Antibody (NBP1-55383)

Learn more about PTMs related to MYL9 Antibody (NBP1-55383).

Blogs on MYL9

There are no specific blogs for MYL9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYL9 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MYL9