MYL9 Antibody

Images

 
Western Blot: MYL9 Antibody [NBP1-55383] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Gt, Rb, Sh, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYL9 Antibody Summary

Immunogen
Synthetic peptides corresponding to MYL9 (myosin, light chain 9, regulatory). The peptide sequence was selected from the middle region of MYL9. Peptide sequence FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYL9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MYL9 and was validated on Western blot.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
MYL9 Knockout HeLa Cell Lysate
Publications
Read Publication using
NBP1-55383 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MYL9 Antibody

  • LC2020 kDa myosin light chain
  • MLC2Myosin RLC
  • MRLC1MLC-2C
  • myosin regulatory light chain 1
  • Myosin regulatory light chain 2, smooth muscle isoform
  • Myosin regulatory light chain 9
  • Myosin regulatory light chain MRLC1
  • myosin regulatory light polypeptide 9
  • myosin, light chain 9, regulatory
  • myosin, light polypeptide 9, regulatory
  • MYRL2MGC3505

Background

Myosin, a structural component of muscle, consists of two heavy chains and four light chains. MYL9 is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. It binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene. Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30249
Species: Hu, Mu, Xp
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-62625
Species: Hu
Applications: IHC, IHC-P
NBP1-81555
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67486
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-62682
Species: Hu
Applications: IHC, IHC-P
H00085366-M01
Species: Hu, Mu
Applications: WB, ELISA, RNAi
NB110-38889
Species: Hu
Applications: WB, IP
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu, Rt, Po
Applications: WB
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB4470
Species: Multi
Applications: WB, IHC, ICC
NB120-6405
Species: Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP2-30954
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-54719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37897
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for MYL9 Antibody (NBP1-55383)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MYL9 Antibody (NBP1-55383) (0)

There are no reviews for MYL9 Antibody (NBP1-55383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYL9 Antibody (NBP1-55383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MYL9 Products

Bioinformatics Tool for MYL9 Antibody (NBP1-55383)

Discover related pathways, diseases and genes to MYL9 Antibody (NBP1-55383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYL9 Antibody (NBP1-55383)

Discover more about diseases related to MYL9 Antibody (NBP1-55383).
 

Pathways for MYL9 Antibody (NBP1-55383)

View related products by pathway.

PTMs for MYL9 Antibody (NBP1-55383)

Learn more about PTMs related to MYL9 Antibody (NBP1-55383).

Blogs on MYL9

There are no specific blogs for MYL9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYL9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL9