MYL5 Antibody

Images

 
Western Blot: MYL5 Antibody [H00004636-D01P] - Analysis of MYL5 expression in transfected 293T cell line by MYL5 polyclonal antibody.Lane 1: MYL5 transfected lysate(19.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MYL5 Antibody Summary

Immunogen
MYL5 (NP_002468.1, 1 a.a. - 173 a.a.) full-length human protein. MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Specificity
MYL5 - myosin, light chain 5, regulatory,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYL5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MYL5 Antibody

  • light polypeptide 5, regulatory
  • MYLC2
  • myLC-2
  • myosin light chain 5
  • Myosin regulatory light chain 5
  • myosin, light chain 5, regulatory
  • Superfast myosin regulatory light chain 2

Background

This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07799
Species: Hu
NBP2-56499
Species: Hu
Applications: ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NB100-1687
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-54719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
AF238
Species: Hu
Applications: WB, Neut

Publications for MYL5 Antibody (H00004636-D01P) (0)

There are no publications for MYL5 Antibody (H00004636-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYL5 Antibody (H00004636-D01P) (0)

There are no reviews for MYL5 Antibody (H00004636-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYL5 Antibody (H00004636-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MYL5 Products

Bioinformatics Tool for MYL5 Antibody (H00004636-D01P)

Discover related pathways, diseases and genes to MYL5 Antibody (H00004636-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYL5 Antibody (H00004636-D01P)

Discover more about diseases related to MYL5 Antibody (H00004636-D01P).
 

Pathways for MYL5 Antibody (H00004636-D01P)

View related products by pathway.

PTMs for MYL5 Antibody (H00004636-D01P)

Learn more about PTMs related to MYL5 Antibody (H00004636-D01P).

Blogs on MYL5

There are no specific blogs for MYL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL5
Entrez
Uniprot