MYF6 Antibody [PerCP]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: PerCP

MYF6 Antibody [PerCP] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human MYF6 (NP_002460.1).
  
  Sequence:
  WACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYF6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for MYF6 Antibody [PerCP]

• bHLHc4BHLHC4
• Class C basic helix-loop-helix protein 4
• MRF4
• MRF4myogenic factor 6
• Muscle-specific regulatory factor 4
• myf-6
• myogenic factor 6 (herculin)

Background

MYF6 (Myogenic factor 6 or herculin) is a 242 amino acid basic helix-loop-helix DNA binding protein that is involved in muscle differentiation. It induces fibroblasts to differentiate into myoblasts. Defects in MYF6 may be a cause of centronuclear myopathy type 3. It may also play a role in muscular dystrophy, rhabdomyosarcoma, myopathy, centronuclear myopathy, alveolar soft part sarcoma and myasthenia gravis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYF6