MYF6 Antibody - BSA Free Summary
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein MYF6 using the following amino acid sequence: FETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAP |
| Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MYF6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MYF6 Antibody - BSA Free
Background
MYF6 (Myogenic factor 6 or herculin) is a 242 amino acid basic helix-loop-helix DNA binding protein that is involved in muscle differentiation. It induces fibroblasts to differentiate into myoblasts. Defects in MYF6 may be a cause of centronuclear myopathy type 3. It may also play a role in muscular dystrophy, rhabdomyosarcoma, myopathy, centronuclear myopathy, alveolar soft part sarcoma and myasthenia gravis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: IHC, WB
Species: Ch, Hu, Mu, Rt
Applications: ICC, IHC
Species: ChHa, Hu
Applications: IP, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Publications for MYF6 Antibody (NBP3-25003) (0)
There are no publications for MYF6 Antibody (NBP3-25003).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MYF6 Antibody (NBP3-25003) (0)
There are no reviews for MYF6 Antibody (NBP3-25003).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MYF6 Antibody (NBP3-25003) (0)