Myelin PLP Antibody (2D7)


Immunocytochemistry/ Immunofluorescence: Myelin PLP Antibody (2D7) [H00005354-M03] - Analysis of monoclonal antibody to PLP1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: Myelin PLP Antibody (2D7) [H00005354-M03] - Detection limit for recombinant GST tagged PLP1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF

Order Details

Myelin PLP Antibody (2D7) Summary

PLP1 (NP_000524 177 a.a. - 232 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAE
Oligodendrocyte Marker
PLP1 - proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated) (2D7)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myelin PLP Antibody (2D7)

  • DM-20
  • HLD1
  • Lipophilin
  • major myelin proteolipid protein
  • MMPL
  • Myelin PLP
  • myelin proteolipid protein
  • PLP
  • PLP/DM20
  • PLP1
  • PMD
  • proteolipid protein 1
  • spastic paraplegia 2, uncomplicated
  • SPG2


This gene encodes a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Myelin PLP Antibody (H00005354-M03) (0)

There are no publications for Myelin PLP Antibody (H00005354-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myelin PLP Antibody (H00005354-M03) (0)

There are no reviews for Myelin PLP Antibody (H00005354-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Myelin PLP Antibody (H00005354-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Myelin PLP Products

Bioinformatics Tool for Myelin PLP Antibody (H00005354-M03)

Discover related pathways, diseases and genes to Myelin PLP Antibody (H00005354-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myelin PLP Antibody (H00005354-M03)

Discover more about diseases related to Myelin PLP Antibody (H00005354-M03).

Pathways for Myelin PLP Antibody (H00005354-M03)

View related products by pathway.

PTMs for Myelin PLP Antibody (H00005354-M03)

Learn more about PTMs related to Myelin PLP Antibody (H00005354-M03).

Research Areas for Myelin PLP Antibody (H00005354-M03)

Find related products by research area.

Blogs on Myelin PLP

There are no specific blogs for Myelin PLP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Myelin PLP Antibody (2D7) and receive a gift card or discount.


Gene Symbol PLP1