Myelin PLP Antibody (2D7) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: Myelin PLP Antibody (2D7) [H00005354-M03] - Analysis of monoclonal antibody to PLP1 on HeLa cell. Antibody concentration 10 ug/ml

ELISA: Myelin PLP Antibody (2D7) [H00005354-M03] - Detection limit for recombinant GST tagged PLP1 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2D7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Myelin PLP Antibody (2D7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PLP1 (NP_000524, 177 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAE
• Marker: Oligodendrocyte Marker
• Specificity: PLP1 - proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated) (2D7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PLP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 10 ug/ml
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myelin PLP Antibody (2D7) - Azide and BSA Free

• DM-20
• HLD1
• Lipophilin
• major myelin proteolipid protein
• MMPL
• Myelin PLP
• myelin proteolipid protein
• PLP
• PLP/DM20
• PLP1
• PMD
• proteolipid protein 1
• spastic paraplegia 2, uncomplicated
• SPG2

Background

This gene encodes a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLP1
• Entrez:
  • 5354(Human)
• Uniprot:
  • NP_000524(Human)