Myelin expression factor 2 Antibody


Western Blot: Myelin expression factor 2 Antibody [NBP2-87863] - WB Suggested Anti-MYEF2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: PANC1 cell lysate

Product Details

Reactivity Hu, Mu, Rt, Gp, RbSpecies Glossary
Applications WB

Order Details

Myelin expression factor 2 Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of human Myelin expression factor 2. Peptide sequence: PAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEKSTGSKKANRFHPYS The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (93%), Guinea Pig (92%), Rabbit (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for Myelin expression factor 2 Antibody

  • FLJ11213
  • HsT18564
  • KIAA1341MSTP156
  • MEF-2myEF-2
  • MGC87325
  • MST156
  • MyEF-2
  • myelin expression factor 2
  • myelin gene expression factor 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu, Mu, Xp
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo, KD
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Gp, Rb
Applications: WB

Publications for Myelin expression factor 2 Antibody (NBP2-87863) (0)

There are no publications for Myelin expression factor 2 Antibody (NBP2-87863).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myelin expression factor 2 Antibody (NBP2-87863) (0)

There are no reviews for Myelin expression factor 2 Antibody (NBP2-87863). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Myelin expression factor 2 Antibody (NBP2-87863) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Myelin expression factor 2 Products

Bioinformatics Tool for Myelin expression factor 2 Antibody (NBP2-87863)

Discover related pathways, diseases and genes to Myelin expression factor 2 Antibody (NBP2-87863). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myelin expression factor 2 Antibody (NBP2-87863)

Discover more about diseases related to Myelin expression factor 2 Antibody (NBP2-87863).

Pathways for Myelin expression factor 2 Antibody (NBP2-87863)

View related products by pathway.

Blogs on Myelin expression factor 2

There are no specific blogs for Myelin expression factor 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Myelin expression factor 2 Antibody and receive a gift card or discount.


Gene Symbol MYEF2