MuSK Antibody (4E5.)

Images

 
Western Blot: MuSK Antibody (4E5) [H00004593-M02] - MUSK monoclonal antibody (M02), clone 4E5 Analysis of MUSK expression in Jurkat.
Sandwich ELISA: MuSK Antibody (4E5) [H00004593-M02] - Detection limit for recombinant GST tagged MUSK is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4E5.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MuSK Antibody (4E5.) Summary

Immunogen
MUSK (NP_005583 301 a.a. - 400 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLA
Specificity
MUSK (4E5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MUSK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MuSK Antibody (4E5.)

  • EC 2.7.10
  • EC 2.7.10.1
  • MGC126323
  • MGC126324
  • muscle, skeletal, receptor tyrosine kinase
  • MuSK
  • skeletal receptor tyrosine-protein kinase

Background

Intercellular communication is often mediated by receptors on the surface of one cell that recognize and are activated by specific protein ligands released by other cells. Members of one class of cell surface receptors, receptor tyrosine kinases (RTKs), are characterized by having a cytoplasmic domain containing intrinsic tyrosine kinase activity. This kinase activity is regulated by the binding of a cognate ligand to the extracellular portion of the receptor. DeChiara et al. (1996) [PubMed 8653786] noted that the RTKs, known to be expressed in cell type-specific fashions, play a role critical for the growth and differentiation of those cell types. For example, members of the neural-specific TRK family that recognize nerve growth factor are absolutely required for the survival and development of discrete neuronal subpopulations, and the receptor tyrosine kinases TIE1 (MIM 600222) and TIE2 (MIM 600221) play a critical role in the development of normal blood vessels.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
NBP2-49600
Species: Hu
Applications: IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004593-M02
Species: Hu
Applications: WB, ELISA

Publications for MuSK Antibody (H00004593-M02) (0)

There are no publications for MuSK Antibody (H00004593-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MuSK Antibody (H00004593-M02) (0)

There are no reviews for MuSK Antibody (H00004593-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MuSK Antibody (H00004593-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MuSK Products

Bioinformatics Tool for MuSK Antibody (H00004593-M02)

Discover related pathways, diseases and genes to MuSK Antibody (H00004593-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MuSK Antibody (H00004593-M02)

Discover more about diseases related to MuSK Antibody (H00004593-M02).
 

Pathways for MuSK Antibody (H00004593-M02)

View related products by pathway.

PTMs for MuSK Antibody (H00004593-M02)

Learn more about PTMs related to MuSK Antibody (H00004593-M02).
 

Research Areas for MuSK Antibody (H00004593-M02)

Find related products by research area.

Blogs on MuSK

There are no specific blogs for MuSK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MuSK Antibody (4E5.) and receive a gift card or discount.

Bioinformatics

Gene Symbol MUSK
Entrez
OMIM
Uniprot