Mus81 Antibody

Images

 
Western Blot: Mus81 Antibody [NBP2-32474] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line SK-MEL-30
Immunohistochemistry-Paraffin: Mus81 Antibody [NBP2-32474] - Staining of human esophagus shows moderate nucleolar positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mus81 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQRLYQGHTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLMQVRGVSGEKAAALVDRYSTPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MUS81
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Mus81 Protein (NBP2-32474PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mus81 Antibody

  • crossover junction endonuclease MUS81
  • EC 3.1.22
  • EC 3.1.22.-
  • FLJ21012
  • FLJ44872
  • MUS81 endonuclease homolog (S. cerevisiae)
  • MUS81 endonuclease homolog (yeast)
  • SLX3 structure-specific endonuclease subunit homolog
  • SLX3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00146956-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-28680
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56320
Species: Hu
Applications: WB
H00007156-R01
Species: Hu
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-32474
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Mus81 Antibody (NBP2-32474) (0)

There are no publications for Mus81 Antibody (NBP2-32474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mus81 Antibody (NBP2-32474) (0)

There are no reviews for Mus81 Antibody (NBP2-32474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mus81 Antibody (NBP2-32474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mus81 Products

Bioinformatics Tool for Mus81 Antibody (NBP2-32474)

Discover related pathways, diseases and genes to Mus81 Antibody (NBP2-32474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mus81 Antibody (NBP2-32474)

Discover more about diseases related to Mus81 Antibody (NBP2-32474).
 

Pathways for Mus81 Antibody (NBP2-32474)

View related products by pathway.

PTMs for Mus81 Antibody (NBP2-32474)

Learn more about PTMs related to Mus81 Antibody (NBP2-32474).
 

Research Areas for Mus81 Antibody (NBP2-32474)

Find related products by research area.

Blogs on Mus81

There are no specific blogs for Mus81, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mus81 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MUS81