MUC5B Antibody - Azide and BSA Free

Western Blot: MUC5B Antibody [H00727897-A01] - Detection against Immunogen (38.21 KDa).

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MUC5B Antibody - Azide and BSA Free Summary

• Immunogen: MUC5B (XP_039877.9, 4186 a.a. - 4295 a.a.) partial recombinant protein with GST tag. CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MUC5B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50% Glycerol
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MUC5B Antibody - Azide and BSA Free

• high molecular weight salivary mucin MG1
• mucin 5, subtype B, tracheobronchial
• mucin 5B, oligomeric mucus/gel-forming
• sublingual gland mucin
• tracheobronchial

Background

MUC5B, also known as Mucin 5B, is a long 5762 amino acid protein that is 596 kDa, expressed on surface airway epithelia, it is a major contributor to the lubricating and viscoelastic properties of whole saliva, normal lung mucus and cervical mucus. Disease research is being performed in relation to MUC5B and chronic obstructive pulmonary disease, cervicitis, sinusitis, polyposis, pseudomyxoma peritonei, otitis media, dry eye syndrome, ampulla of vater carcinoma, common cold, copd, dental caries, diffuse panbronchiolitis, biliary papillomatosis, panbronchiolitis, atrophic gastritis, Barrett's esophagus, cystic fibrosis lung disease, peptic ulcer, bronchitis, gastritis, sinusitis, asthma, laryngitis, and nasopharyngitis. This protein has been shown to have interactions with AMY1A, AMY1B, AMY1C, HTN1, STATH, and over 40 other proteins in Addition of GalNAc to the Tn antigen via an alpha-1,6 linkage forms a Core 7 glycoprotein, O-linked glycosylation of mucins, Metabolism of proteins, Post-translational protein modification, Addition of galactose to the Tn antigen via an alpha-1,3 linkage forms a Core 8 glycoprotein, Addition of GlcNAc to the Tn antigen via a beta-1,6 linkage forms a Core 6 glycoprotein, Termination of O-glycan biosynthesis, Salivary secretion, Mucin expression in CF via TLRs, EGFR signaling pathways, Mucin expression in CF via IL-6, IL-17 signaling pathways, and Selected targets of CREB1 pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MUC5B Antibody (H00727897-A01)(2)

Publications using H00727897-A01

• Du RH, Richmond BW, Blackwell TS Jr et al. Secretory IgA from submucosal glands does not compensate for its airway surface deficiency in chronic obstructive pulmonary disease. Virchows Arch 2015-12-01 [PMID: 26432569]
• Taniguchi M, Iizuka J, Murata Y et al. Multimolecular Salivary Mucin Complex Is Altered in Saliva of Cigarette Smokers: Detection of Disulfide Bridges by Raman Spectroscopy. BioMed Research International. 2013-01-01 [PMID: 23509686]

Bioinformatics

• Gene Symbol: MUC5B
• Uniprot:
  • XP_039877(Human)