MUC5B Antibody - Azide and BSA Free Summary
Immunogen |
MUC5B (XP_039877.9, 4186 a.a. - 4295 a.a.) partial recombinant protein with GST tag. CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
MUC5B |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This antibody is useful for ELISA, Western Blot |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
50% Glycerol |
Preservative |
No Preservative |
Purity |
Immunogen affinity purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MUC5B Antibody - Azide and BSA Free
Background
MUC5B, also known as Mucin 5B, is a long 5762 amino acid protein that is 596 kDa, expressed on surface airway epithelia, it is a major contributor to the lubricating and viscoelastic properties of whole saliva, normal lung mucus and cervical mucus. Disease research is being performed in relation to MUC5B and chronic obstructive pulmonary disease, cervicitis, sinusitis, polyposis, pseudomyxoma peritonei, otitis media, dry eye syndrome, ampulla of vater carcinoma, common cold, copd, dental caries, diffuse panbronchiolitis, biliary papillomatosis, panbronchiolitis, atrophic gastritis, Barrett's esophagus, cystic fibrosis lung disease, peptic ulcer, bronchitis, gastritis, sinusitis, asthma, laryngitis, and nasopharyngitis. This protein has been shown to have interactions with AMY1A, AMY1B, AMY1C, HTN1, STATH, and over 40 other proteins in Addition of GalNAc to the Tn antigen via an alpha-1,6 linkage forms a Core 7 glycoprotein, O-linked glycosylation of mucins, Metabolism of proteins, Post-translational protein modification, Addition of galactose to the Tn antigen via an alpha-1,3 linkage forms a Core 8 glycoprotein, Addition of GlcNAc to the Tn antigen via a beta-1,6 linkage forms a Core 6 glycoprotein, Termination of O-glycan biosynthesis, Salivary secretion, Mucin expression in CF via TLRs, EGFR signaling pathways, Mucin expression in CF via IL-6, IL-17 signaling pathways, and Selected targets of CREB1 pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, mIF, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, IP, WB
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, IHC, IHC-P, S-ELISA, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: IHC, IHC-P
Publications for MUC5B Antibody (H00727897-A01)(2)
Showing Publications 1 -
2 of 2.
Reviews for MUC5B Antibody (H00727897-A01) (0)
There are no reviews for MUC5B Antibody (H00727897-A01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MUC5B Antibody (H00727897-A01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MUC5B Products
Research Areas for MUC5B Antibody (H00727897-A01)
Find related products by research area.
|
Blogs on MUC5B