MUC2 Antibody (2A9)

Images

 
Immunocytochemistry/ Immunofluorescence: MUC2 Antibody (2A9) [H00004583-M15] - Analysis of monoclonal antibody to MUC2 on HeLa cell. Antibody concentration 20 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, ICC/IF
Clone
2A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MUC2 Antibody (2A9) Summary

Immunogen
MUC2 (NP_002448, 4993 a.a. ~ 5078 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. THCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTV
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MUC2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA.
Theoretical MW
540 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MUC2 Antibody (2A9)

  • Intestinal mucin-2
  • MLP
  • MUC2
  • MUC-2
  • mucin 2, intestinal/tracheal
  • mucin 2, oligomeric mucus/gel-forming
  • mucin-2
  • SMUC

Background

MUC2, also called mucin 2, is a member of the mucin protein family which are heavily glycosylated, high molecular weight proteins that are produced by goblet cells in epithelial tissues including the intestinal and respiratory tract (1). Mucins can form gels and function in lubrication of mucosal surfaces which serve as a protective barrier of the epithelial lining and an innate host defense (1). Mucins are divided into two groups based on whether they are membrane-bound or secreted, where MUC2 belongs to the secretory group (1,2). Secreted mucins have a distinctive composition characterized by a large central exon "mucin domain" containing O-glycosylated tandem repeat regions rich in proline, threonine, and serine residues, non-repetitive domains, and cysteine-rich domains (1,2). The mucin domain is flanked by 5' and 3' D domains, a B-like domain, a C-like domain, and a Ck-domain (1,2). MUC2 was the first secretory mucin identified in humans (3,4). Full-length MUC2 protein is synthesized as 5179 amino acids (aa) in length with a theoretical molecular weight of ~540 kDa (5).

Changes or perturbations to MUC2 expression has been associated with a number of disease pathologies (1-4, 6). Specifically, altered MUC2 composition has been indicated in colorectal cancer, inflammatory bowel diseases (IBD) including ulcerative colitis and Chron's disease, and chronic obstructive pulmonary disease (COPD) (1-4, 6). In general, decreased or reduced MUC2 expression is associated with colorectal cancer disease progression and development of IBD (1-4, 6). Additionally, studies have found that upon intestinal infection due to parasites or bacteria MUC2 expression is increased, as is overall mucus secretion (3, 6).

References

1. Pothuraju, R., Krishn, S. R., Gautam, S. K., Pai, P., Ganguly, K., Chaudhary, S., Rachagani, S., Kaur, S., & Batra, S. K. (2020). Mechanistic and Functional Shades of Mucins and Associated Glycans in Colon Cancer. Cancers. https://doi.org/10.3390/cancers12030649

2. Ballester, B., Milara, J., & Cortijo, J. (2019). Mucins as a New Frontier in Pulmonary Fibrosis. Journal of Clinical Medicine. https://doi.org/10.3390/jcm8091447

3. Liu, Y., Yu, X., Zhao, J., Zhang, H., Zhai, Q., & Chen, W. (2020). The role of MUC2 mucin in intestinal homeostasis and the impact of dietary components on MUC2 expression. International Journal of Biological Macromolecules. https://doi.org/10.1016/j.ijbiomac.2020.07.191

4. Allen, A., Hutton, D. A., & Pearson, J. P. (1998). The MUC2 gene product: a human intestinal mucin. The International Journal of Biochemistry & Cell Biology. https://doi.org/10.1016/s1357-2725(98)00028-4

5. Uniprot (Q02817)

6. Kim, Y. S., & Ho, S. B. (2010). Intestinal goblet cells and mucins in health and disease: recent insights and progress. Current Gastroenterology Reports. https://doi.org/10.1007/s11894-010-0131-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15196
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-44374
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-44434
Species: Hu, Rt(-)
Applications: Flow, ICC/IF, IF, IHC, IHC-P
NBP2-24583
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-47940
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DTFF30
Species: Hu
Applications: ELISA
NBP1-06983
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
NBP1-82045
Species: Hu
Applications: IHC, IHC-P
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
H00004583-M15
Species: Hu
Applications: ELISA, ICC/IF

Publications for MUC2 Antibody (H00004583-M15) (0)

There are no publications for MUC2 Antibody (H00004583-M15).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUC2 Antibody (H00004583-M15) (0)

There are no reviews for MUC2 Antibody (H00004583-M15). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MUC2 Antibody (H00004583-M15) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUC2 Products

Array H00004583-M15

Bioinformatics Tool for MUC2 Antibody (H00004583-M15)

Discover related pathways, diseases and genes to MUC2 Antibody (H00004583-M15). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC2 Antibody (H00004583-M15)

Discover more about diseases related to MUC2 Antibody (H00004583-M15).
 

Pathways for MUC2 Antibody (H00004583-M15)

View related products by pathway.

PTMs for MUC2 Antibody (H00004583-M15)

Learn more about PTMs related to MUC2 Antibody (H00004583-M15).
 

Research Areas for MUC2 Antibody (H00004583-M15)

Find related products by research area.

Blogs on MUC2

There are no specific blogs for MUC2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MUC2 Antibody (2A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol MUC2
Entrez
OMIM
Uniprot