MUC1 Antibody [DyLight 680]


There are currently no images for MUC1 Antibody (NBP1-60046FR).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Reactivity Hu, Mu, Rt, Po, Bv, Eq, GP, Gt, RbSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
DyLight 680

MUC1 Antibody [DyLight 680] Summary

Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal of MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Goat reactivity reported in scientific literature (PMID: 28740504), Expected identity based on immunogen sequence: Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%

Packaging, Storage & Formulations

Store at 4C in the dark.
50mM Sodium Borate
0.05% Sodium Azide
Immunogen affinity purified


Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for MUC1 Antibody [DyLight 680]

  • Breast carcinoma-associated antigen DF3
  • Carcinoma-associated mucin
  • CD227 antigen
  • CD227
  • DF3 antigen
  • EMA
  • Episialin
  • H23 antigen
  • H23AG
  • KL-6
  • MAM6
  • MUC-1
  • MUC1/ZD
  • mucin 1, cell surface associated
  • mucin 1, transmembrane
  • Mucin-1
  • Peanut-reactive urinary mucin
  • PEM
  • PEMT
  • Polymorphic epithelial mucin
  • PUMMUC-1/X
  • tumor associated epithelial mucin
  • Tumor-associated epithelial membrane antigen
  • Tumor-associated mucin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: Flow, IHC-P, IF
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC
Species: Hu, Mu, Rt, Po, Bv, Eq, GP, Gt, Rb
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MUC1 Antibody (NBP1-60046FR) (0)

There are no publications for MUC1 Antibody (NBP1-60046FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MUC1 Antibody (NBP1-60046FR) (0)

There are no reviews for MUC1 Antibody (NBP1-60046FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MUC1 Antibody (NBP1-60046FR). (Showing 1 - 1 of 1 FAQ).

  1. I would like to perform a sandwich assay for the determination of MUC1 protein. May you suggest me some antibodies that can be used together? In particular, if possible, I should need antibodies product in mouse or rabbit.
    • Unfortunately we are not aware of a pair of antibodies that have been used in sandwich ELISA in particular. If you are interested in trying two you may find our Innovators Reward Program to be helpful.

Secondary Antibodies


Isotype Controls

Other Available Formats

Alexa Fluor 488 Labeled NBP1-60046AF488
Alexa Fluor 647 Labeled NBP1-60046AF647
Biotin Labeled NBP1-60046B
DyLight 350 Labeled NBP1-60046UV
DyLight 405 Labeled NBP1-60046V
DyLight 488 Labeled NBP1-60046G
DyLight 550 Labeled NBP1-60046R
DyLight 650 Labeled NBP1-60046C
DyLight 755 Labeled NBP1-60046IR
HRP Labeled NBP1-60046H

Additional Array Products

Bioinformatics Tool for MUC1 Antibody (NBP1-60046FR)

Discover related pathways, diseases and genes to MUC1 Antibody (NBP1-60046FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUC1 Antibody (NBP1-60046FR)

Discover more about diseases related to MUC1 Antibody (NBP1-60046FR).

Pathways for MUC1 Antibody (NBP1-60046FR)

View related products by pathway.

PTMs for MUC1 Antibody (NBP1-60046FR)

Learn more about PTMs related to MUC1 Antibody (NBP1-60046FR).

Research Areas for MUC1 Antibody (NBP1-60046FR)

Find related products by research area.

Blogs on MUC1

There are no specific blogs for MUC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MUC1 Antibody

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MUC1 Antibody [DyLight 680] and receive a gift card or discount.


Gene Symbol MUC1