MTRR Antibody - Azide and BSA Free

Images

 
Western Blot: MTRR Antibody [NBP2-93732] - Analysis of extracts of various cell lines, using MTRR at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25 ug per ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

MTRR Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 50-230 of human MTRR (NP_002445.2). TAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDKRLQELGARHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASSRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTRR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:2000
Reviewed Applications
Read 1 Review rated 4
using
NBP2-93732 in the following application:

Reactivity Notes

Per customer review Mouse reactivity was negative.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for MTRR Antibody - Azide and BSA Free

  • [methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing)
  • 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
  • cblE
  • EC 1.16.1.8
  • methionine synthase reductase
  • methionine synthase reductase, mitochondrial
  • MGC129643
  • MSR

Background

MTRR, also known as Methionine synthase reductase, consists of 3 isoforms, a 725 amino acid isoform 1 that is 80 kDa, a 658 amino acid isoform 2 that is 78 kDa and 58 amino acid isoform 2 that is 6 kDa, cytoplasm located, found in all tissues tested, particularly abundant in skeletal muscle, regenerates a functional methionine synthase via reductive methylation, and it is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Current research is being performed onseveral diseases and disorders including homocystinuria-megaloblastic anemia cbl e type, neural tube defects folate-sensitive, homocystinuria-megaloblastic anemia, neural tube defect, cble, disorders of intracellular cobalamin metabolism, megaloblastic anemia, homocysteine, diffuse large b-cell lymphoma, homocysteine plasma level, cleft lip/palate, age related macular degeneration, deep vein thrombosis, homocystinuria, patent ductus arteriosus, spina bifida, b-cell lymphomas, methylcobalamin deficiency, abdominal aortic aneurysm, hyperhomocysteinemia, and Down syndrome. The protein has been linked to the Antimetabolite Pathway - Folate Cycle, Pharmacodynamics, Methotrexate Pathway (Cancer Cell) Pharmacodynamics, Thiopurine Pathway Pharmacokinetics/Pharmacodynamics, One Carbon Metabolism, Folate Metabolism, Sulfur amino acid metabolism, Biological oxidations, Metabolism of amino acids and derivatives, and Phase II conjugation pathways where it interacts with MMAB, ELAVL1, and UBC proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NB100-791
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00000875-M01
Species: Ba, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85437
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59904
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-82612
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
AF7895
Species: Hu
Applications: IHC, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP1-71693
Species: Hu
Applications: ICC/IF, WB
NBP1-00161
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-80755
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-45057
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB

Publications for MTRR Antibody (NBP2-93732) (0)

There are no publications for MTRR Antibody (NBP2-93732).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MTRR Antibody (NBP2-93732) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human and Mouse.

Reviews using NBP2-93732:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MTRR NBP2-93732
Enlarge
4
reviewed by:
Hua Jiang
WB Human and Mouse 08/16/2021
View

Summary

ApplicationWestern Blot
Sample Testedhela cell,Human muscle cells,mouse liver
SpeciesHuman and Mouse
Lot0209600401

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTRR Antibody (NBP2-93732) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTRR Products

Diseases for MTRR Antibody (NBP2-93732)

Discover more about diseases related to MTRR Antibody (NBP2-93732).
 

Pathways for MTRR Antibody (NBP2-93732)

View related products by pathway.

PTMs for MTRR Antibody (NBP2-93732)

Learn more about PTMs related to MTRR Antibody (NBP2-93732).
 

Research Areas for MTRR Antibody (NBP2-93732)

Find related products by research area.

Blogs on MTRR

There are no specific blogs for MTRR, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Hua Jiang
08/16/2021
Application: WB
Species: Human and Mouse

Bioinformatics

Gene Symbol MTRR