MTMR3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHRAGIEIQEGKEDPLLEKESRRKTPEASAIGLH |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MTMR3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MTMR3 Antibody - BSA Free
Background
MTMR3encodes a member of the myotubularin dual specificity protein phosphatase gene family. The encoded protein is structurally similar to myotubularin but in addition contains a FYVE domain and an N-terminal PH-GRAM domain. The protein can self-associate and also form heteromers with another myotubularin related protein. The protein binds to phosphoinositide lipids through the PH-GRAM domain, and can hydrolyze phosphatidylinositol(3)-phosphate and phosphatidylinositol(3,5)-biphosphate in vitro. The encoded protein has been observed to have a perinuclear, possibly membrane-bound, distribution in cells, but it has also been found free in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Publications for MTMR3 Antibody (NBP1-81860) (0)
There are no publications for MTMR3 Antibody (NBP1-81860).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MTMR3 Antibody (NBP1-81860) (0)
There are no reviews for MTMR3 Antibody (NBP1-81860).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MTMR3 Antibody (NBP1-81860) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MTMR3 Products
Research Areas for MTMR3 Antibody (NBP1-81860)
Find related products by research area.
|
Blogs on MTMR3