MTHFD2 Antibody


Western Blot: MTHFD2 Antibody [NBP1-54655] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MTHFD2 Antibody Summary

Synthetic peptides corresponding to MTHFD2(methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 ) The peptide sequence was selected from the N terminal of MTHFD2. Peptide sequence LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MTHFD2 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MTHFD2 Antibody

  • bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase
  • methenyltetrahydrofolate cyclohydrolase
  • methylene tetrahydrofolate dehydrogenase (NAD+ dependent)
  • methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2
  • mitochondrial
  • NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase


MTHFD2 is a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD.This gene encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in multiple transcripts encoding different isoforms. This gene has a pseudogene on chromosome 7.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, ICC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MTHFD2 Antibody (NBP1-54655) (0)

There are no publications for MTHFD2 Antibody (NBP1-54655).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTHFD2 Antibody (NBP1-54655) (0)

There are no reviews for MTHFD2 Antibody (NBP1-54655). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTHFD2 Antibody (NBP1-54655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MTHFD2 Products

Bioinformatics Tool for MTHFD2 Antibody (NBP1-54655)

Discover related pathways, diseases and genes to MTHFD2 Antibody (NBP1-54655). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTHFD2 Antibody (NBP1-54655)

Discover more about diseases related to MTHFD2 Antibody (NBP1-54655).

Pathways for MTHFD2 Antibody (NBP1-54655)

View related products by pathway.

PTMs for MTHFD2 Antibody (NBP1-54655)

Learn more about PTMs related to MTHFD2 Antibody (NBP1-54655).

Research Areas for MTHFD2 Antibody (NBP1-54655)

Find related products by research area.

Blogs on MTHFD2.

Vimentin: Regulating EMT and Cancer
Vimentin, a member of the intermediate filament (IF) family, is a protein responsible for maintaining cellular integrity and reducing damage caused by stress. The vimentin protein is ubiquitously expressed in normal mesenchymal cells, and recent resea...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MTHFD2 Antibody and receive a gift card or discount.


Gene Symbol MTHFD2