MTA2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTA2 Source: E.coli
Amino Acid Sequence: KTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MTA2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21357. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MTA2 Recombinant Protein Antigen
Background
Official Gene Symbol: MTA2 Gen Bank Accession Number: NP_004730 Gene ID: 9219 (Human) Gene Map Locus: 11q12-q13.1 (human) MTA2, a homologue of human MTA1 and MTA3, is a member of highly conserved MTA gene family. It is a component of NuRD, an ATP-dependent nucleosome remodeling and histone deacetylase complex. MTA2 is a nuclear protein that interacts with HDAC1 and HDAC2 and has a functional role in chromatin remodeling and deacetylase activity. MTA2 specifically interacts with p53 and represses p53-dependant transcriptional activation, thereby regulating p53-mediated cell growth arrest and apoptosis. It also inhibits the transcriptional activity of Estrogen receptor-alpha. Northern Blot analysis detected a ubiquitous expression of MTA2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Publications for MTA2 Recombinant Protein Antigen (NBP3-21357PEP) (0)
There are no publications for MTA2 Recombinant Protein Antigen (NBP3-21357PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MTA2 Recombinant Protein Antigen (NBP3-21357PEP) (0)
There are no reviews for MTA2 Recombinant Protein Antigen (NBP3-21357PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MTA2 Recombinant Protein Antigen (NBP3-21357PEP) (0)
Additional MTA2 Products
Research Areas for MTA2 Recombinant Protein Antigen (NBP3-21357PEP)
Find related products by research area.
|
Blogs on MTA2