Recombinant Human MTA1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MTA1 Protein Summary

Description
MTA1 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
MTA1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MTA1 Protein

  • metastasis associated 1
  • metastasis associated gene 1 protein
  • metastasis associated protein
  • metastasis-associated protein MTA1

Background

MTA1 - metastasis associated 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83549
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56483
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2306
Species: Hu
Applications: WB, IHC-P, IP
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, TCS, KO, LA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-24694
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
NBP2-50163
Species: Hu, Mu
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready

Publications for MTA1 Partial Recombinant Protein (H00009112-Q01) (0)

There are no publications for MTA1 Partial Recombinant Protein (H00009112-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTA1 Partial Recombinant Protein (H00009112-Q01) (0)

There are no reviews for MTA1 Partial Recombinant Protein (H00009112-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTA1 Partial Recombinant Protein (H00009112-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTA1 Products

Bioinformatics Tool for MTA1 Partial Recombinant Protein (H00009112-Q01)

Discover related pathways, diseases and genes to MTA1 Partial Recombinant Protein (H00009112-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTA1 Partial Recombinant Protein (H00009112-Q01)

Discover more about diseases related to MTA1 Partial Recombinant Protein (H00009112-Q01).
 

Pathways for MTA1 Partial Recombinant Protein (H00009112-Q01)

View related products by pathway.

PTMs for MTA1 Partial Recombinant Protein (H00009112-Q01)

Learn more about PTMs related to MTA1 Partial Recombinant Protein (H00009112-Q01).
 

Research Areas for MTA1 Partial Recombinant Protein (H00009112-Q01)

Find related products by research area.

Blogs on MTA1

There are no specific blogs for MTA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MTA1 Antibody
NB600-260
MTA1 Antibody
NB600-260
MTA1 Antibody
NB600-260
c-Myc Antibody
NB600-335
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MTA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTA1