MT-CO2 Antibody - Azide and BSA Free

Western Blot: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] - Western blot analysis of lysates from HeLa cells, using MT-CO2 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] - Immunofluorescence analysis of HepG2 cells using MT-CO2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] - Immunohistochemistry analysis of paraffin-embedded Human colon using MT-CO2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: MT-CO2 Antibody - Azide and BSA Free [NBP2-93084] - Immunohistochemistry analysis of paraffin-embedded Rat colon using MT-CO2 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MT-CO2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MT-CO2 Antibody - Azide and BSA Free (NBP2-93084) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-100 of human MT-CO2 (YP_003024029.1). YALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for MT-CO2 Antibody - Azide and BSA Free

• COII
• COX2
• COXII
• Cytochrome C Oxidase II
• Cytochrome C Oxidase Polypeptide II
• Cytochrome C Oxidase Subunit II
• EC 1.9.3.1
• Mitochondrially Encoded Cytochrome C Oxidase II
• MTCO2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: COX2