MSRB3 Antibody - BSA Free

Immunohistochemistry-Paraffin: MSRB3 Antibody [NBP1-84259] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: MSRB3 Antibody [NBP1-84259] - Staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: MSRB3 Antibody [NBP1-84259] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: MSRB3 Antibody [NBP1-84259] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Analysis in human cell line A-549.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MSRB3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC
• Predicted Species: Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MSRB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MSRB3 Protein (NBP1-84259PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MSRB3 Antibody - BSA Free

• DFNB74
• DKFZp686C1178
• EC 1.8.4.-
• EC 1.8.4.12
• FLJ36866
• methionine sulfoxide reductase B3
• methionine-R-sulfoxide reductase B3
• methionine-R-sulfoxide reductase B3, mitochondrial
• MsrB3

Background

MSRB3 catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MSRB3 Antibody (NBP1-84259)(5)

Publications using NBP1-84259

• Zhang S, Zang D, Cheng Y et Al. Identification of Key Gene and Pathways for the Prediction of Peritoneal Metastasis of Gastric Cancer by Co-expression Analysis J Cancer 2020-03-04 [PMID: 32226519] (WB, Human)
• Ma X, Wang J, Zhao M et al. Increased expression of methionine sulfoxide reductases B3 is associated with poor prognosis in gastric cancer Oncol Lett 2019-07-01 [PMID: 31289518] (IHC-P, Human)
• Conner SC, Benayoun L, Himali JJ et al. Methionine Sulfoxide Reductase-B3 Risk Allele Implicated in Alzheimer's Disease Associates with Increased Odds for Brain Infarcts J. Alzheimers Dis. 2019-02-11 [PMID: 30775993] (IHC-P, Human)
• Adams SL, Benayoun L, Tilton K et al. Methionine Sulfoxide Reductase-B3 (MsrB3) Protein Associates with Synaptic Vesicles and its Expression Changes in the Hippocampi of Alzheimer's Disease Patients J. Alzheimers Dis. 2017-07-29 [PMID: 28777754] (Human)
• Ahmed ZM, Yousaf R, Lee BC et al. Functional null mutations of MSRB3 encoding methionine sulfoxide reductase are associated with human deafness DFNB74. Am J Hum Genet 2011-01-01 [PMID: 21185009]

Bioinformatics

• Gene Symbol: MSRB3