MSRB3 Antibody

Images

 
Western Blot: MSRB3 Antibody [NBP1-84259] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: MSRB3 Antibody [NBP1-84259] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MSRB3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSRB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MSRB3 Protein (NBP1-84259PEP)
Publications
Read Publications using NBP1-84259.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MSRB3 Antibody

  • DFNB74
  • DKFZp686C1178
  • EC 1.8.4.-
  • EC 1.8.4.12
  • FLJ36866
  • methionine sulfoxide reductase B3
  • methionine-R-sulfoxide reductase B3
  • methionine-R-sulfoxide reductase B3, mitochondrial
  • MsrB3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86594
Species: Hu
Applications: WB, IHC, IHC-P
H00051734-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-87857
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15108
Species: Hu, Mu, Rt
Applications: WB, ChIP, IHC, IHC-P
NBP1-59812
Species: Hu
Applications: WB
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MSRB3 Antibody (NBP1-84259)(2)

Reviews for MSRB3 Antibody (NBP1-84259) (0)

There are no reviews for MSRB3 Antibody (NBP1-84259). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MSRB3 Antibody (NBP1-84259) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MSRB3 Products

Bioinformatics Tool for MSRB3 Antibody (NBP1-84259)

Discover related pathways, diseases and genes to MSRB3 Antibody (NBP1-84259). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSRB3 Antibody (NBP1-84259)

Discover more about diseases related to MSRB3 Antibody (NBP1-84259).
 

Pathways for MSRB3 Antibody (NBP1-84259)

View related products by pathway.

PTMs for MSRB3 Antibody (NBP1-84259)

Learn more about PTMs related to MSRB3 Antibody (NBP1-84259).

Blogs on MSRB3

There are no specific blogs for MSRB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSRB3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSRB3