MSH2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MSH2 Antibody [NBP2-68845] - Staining of human cell line RH-30 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MSH2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSH2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
MSH2 Recombinant Protein Antigen (NBP2-68845PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for MSH2 Antibody

  • COCA1
  • DNA mismatch repair protein Msh2
  • FCC1
  • hMSH2
  • HNPCC
  • HNPCC1
  • HNPCC1mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1)
  • LCFS2
  • MSH2
  • mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
  • MutS protein homolog 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2535
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-46459
Species: Hu
Applications: ICC/IF, IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-19417
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00005378-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88713
Species: Hu
Applications: IHC, IHC-P, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-16391
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for MSH2 Antibody (NBP2-68845) (0)

There are no publications for MSH2 Antibody (NBP2-68845).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSH2 Antibody (NBP2-68845) (0)

There are no reviews for MSH2 Antibody (NBP2-68845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MSH2 Antibody (NBP2-68845) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MSH2 Products

Bioinformatics Tool for MSH2 Antibody (NBP2-68845)

Discover related pathways, diseases and genes to MSH2 Antibody (NBP2-68845). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSH2 Antibody (NBP2-68845)

Discover more about diseases related to MSH2 Antibody (NBP2-68845).
 

Pathways for MSH2 Antibody (NBP2-68845)

View related products by pathway.

PTMs for MSH2 Antibody (NBP2-68845)

Learn more about PTMs related to MSH2 Antibody (NBP2-68845).
 

Research Areas for MSH2 Antibody (NBP2-68845)

Find related products by research area.

Blogs on MSH2

There are no specific blogs for MSH2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSH2