Recombinant Human MS4A6E Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MS4A6E Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 147 of Human MS4A6E full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTSQPISNETIIMLPSNVINFSQAEKPEPTNQGQDSLKKRLQAKVKVIGVHSSLAGSILSALSALVGFILLSVNPAALNPASLQCKLDEKDIPTRLLLSYDYHSPYTMDCHRAKASLAGTLSLMLVSTVLEFCLAVLTAVLQWKQTV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MS4A6E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
42.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MS4A6E Protein

  • membrane-spanning 4-domains subfamily A member 6E
  • membrane-spanning 4-domains, subfamily A, member 6E
  • MGC126832

Background

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7797
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46170
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP1-86543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81026
Species: Hu
Applications: WB, IHC, IHC-P
NB400-166
Species: Mu
Applications: WB, Flow, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-49510
Species: Hu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-93476
Species: Hu
Applications: IHC, IHC-P
NBP2-30744
Species: Hu
Applications: IHC, IHC-P
NBP2-16060
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90895
Species: Hu
Applications: WB, IHC, IHC-P
H00245802-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MS4A6E Recombinant Protein (H00245802-P01) (0)

There are no publications for MS4A6E Recombinant Protein (H00245802-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MS4A6E Recombinant Protein (H00245802-P01) (0)

There are no reviews for MS4A6E Recombinant Protein (H00245802-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MS4A6E Recombinant Protein (H00245802-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MS4A6E Products

MS4A6E H00245802-P01

Bioinformatics Tool for MS4A6E Recombinant Protein (H00245802-P01)

Discover related pathways, diseases and genes to MS4A6E Recombinant Protein (H00245802-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MS4A6E Recombinant Protein (H00245802-P01)

Discover more about diseases related to MS4A6E Recombinant Protein (H00245802-P01).

Blogs on MS4A6E

There are no specific blogs for MS4A6E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MS4A6E RNAi
H00245802-R02-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MS4A6E Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A6E