MS4A6A Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit MS4A6A Antibody - BSA Free (NBP1-86541) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRMGQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSPV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MS4A6A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MS4A6A Antibody - BSA Free
Background
MS4A6A (membrane-spanning 4-domains, subfamily A, member 6A) is a member of the membrane-spanning 4A gene family. MS4A6A may have a role in signal transduction. MS4A6A is currently being studied in relation to adenocarcinoma, Alzheimer's disease, esophagitis, hepatitis and hepatitis B.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: ICC, IP, WB
Species: Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Publications for MS4A6A Antibody (NBP1-86541) (0)
There are no publications for MS4A6A Antibody (NBP1-86541).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MS4A6A Antibody (NBP1-86541) (0)
There are no reviews for MS4A6A Antibody (NBP1-86541).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for MS4A6A Antibody (NBP1-86541) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MS4A6A Products
Research Areas for MS4A6A Antibody (NBP1-86541)
Find related products by research area.
|
Blogs on MS4A6A