MS4A6A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MS4A6A Antibody [NBP1-86541] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and vesicles.
Immunohistochemistry-Paraffin: MS4A6A Antibody [NBP1-86541] - Staining of human pancreas shows strong nuclear positivity in exocrine cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MS4A6A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SFSPNFTQVTSTLLNSAYPFIGPFFVSRVSEEGRMGQRGEEDTNSLDFPPASLLCLICQEQGVNGESCSPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MS4A6A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MS4A6A Protein (NBP1-86541PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MS4A6A Antibody

  • 4SPAN3
  • CD20 antigen-like 3
  • CD20L3
  • CD20L3MS4A6A-polymorph
  • CD20-like precusor
  • CDA01
  • Four-span transmembrane protein 3
  • four-span transmembrane protein 3.1,4SPAN3.2
  • four-span transmembrane protein 3.2
  • HAIRB-iso
  • membrane-spanning 4-domains subfamily A member 6A
  • membrane-spanning 4-domains, subfamily A, member 6A
  • MGC131944
  • MGC22650
  • MS4A6A
  • MS4A6MST090
  • MST090
  • MSTP090

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46170
Species: Hu
Applications: WB, IHC-P, IP
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB400-166
Species: Mu
Applications: WB, Flow, IHC-P
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90895
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP1-86543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7797
Species: Hu
Applications: Flow, CyTOF-ready
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57270
Species: Hu
Applications: ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF2338
Species: Hu
Applications: WB, IP, ICC

Publications for MS4A6A Antibody (NBP1-86541) (0)

There are no publications for MS4A6A Antibody (NBP1-86541).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MS4A6A Antibody (NBP1-86541) (0)

There are no reviews for MS4A6A Antibody (NBP1-86541). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MS4A6A Antibody (NBP1-86541) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MS4A6A Products

Bioinformatics Tool for MS4A6A Antibody (NBP1-86541)

Discover related pathways, diseases and genes to MS4A6A Antibody (NBP1-86541). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MS4A6A Antibody (NBP1-86541)

Discover more about diseases related to MS4A6A Antibody (NBP1-86541).
 

Pathways for MS4A6A Antibody (NBP1-86541)

View related products by pathway.

Blogs on MS4A6A

There are no specific blogs for MS4A6A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MS4A6A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A6A
Entrez