MS4A3 Antibody

Images

 
Western Blot: MS4A3 Antibody [NBP1-86543] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: MS4A3 Antibody [NBP1-86543] - Staining of human cell line U-251MG shows positivity in nuclei but not nucleoli.
Immunohistochemistry-Paraffin: MS4A3 Antibody [NBP1-86543] - Staining of human bone marrow shows moderate cytoplasmic positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MS4A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MS4A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MS4A3 Protein (NBP1-86543PEP)
Publications
Read Publication using NBP1-86543.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25886616)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MS4A3 Antibody

  • CD20 antigen homolog
  • CD20 antigen-like protein
  • CD20L
  • CD20LIgE receptor beta subunit
  • hematopoietic cell 4 transmembrane protein
  • Hematopoietic-specific transmembrane protein 4
  • HTM4
  • HTM4IgE receptor beta chain
  • membrane-spanning 4-domains subfamily A member 3
  • membrane-spanning 4-domains, subfamily A, member 3 (hematopoieticcell-specific)
  • MS4A3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB7797
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86496
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90895
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-52926
Species: Hu
Applications: WB
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57270
Species: Hu
Applications: ICC/IF
NBP1-86540
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4504
Species: Mu
Applications: Flow

Publications for MS4A3 Antibody (NBP1-86543)(1)

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
All Species

Reviews for MS4A3 Antibody (NBP1-86543) (0)

There are no reviews for MS4A3 Antibody (NBP1-86543). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MS4A3 Antibody (NBP1-86543) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MS4A3 Products

Bioinformatics Tool for MS4A3 Antibody (NBP1-86543)

Discover related pathways, diseases and genes to MS4A3 Antibody (NBP1-86543). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MS4A3 Antibody (NBP1-86543)

Discover more about diseases related to MS4A3 Antibody (NBP1-86543).
 

Pathways for MS4A3 Antibody (NBP1-86543)

View related products by pathway.

PTMs for MS4A3 Antibody (NBP1-86543)

Learn more about PTMs related to MS4A3 Antibody (NBP1-86543).

Blogs on MS4A3

There are no specific blogs for MS4A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MS4A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A3
Entrez