Home » Cdk3 » Cdk3 Antibodies » Cdk3 Antibody (3C12)

Cdk3 Antibody (3C12)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Cdk3 Antibody (3C12) [H00001018-M01] - Analysis of CDK3 expression in transfected 293T cell line by CDK3 monoclonal antibody (M01), clone 3C12.Lane 1: CDK3 transfected lysate(35 KDa).Lane 2: Non-transfected lysate.
Western Blot: Cdk3 Antibody (3C12) [H00001018-M01] - Analysis of CDK3 expression in transfected 293T cell line by CDK3 monoclonal antibody (M01), clone 3C12.Lane 1: CDK3 transfected lysate(35 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: Cdk3 Antibody (3C12) [H00001018-M01] - Analysis of monoclonal antibody to CDK3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Sandwich ELISA: Cdk3 Antibody (3C12) [H00001018-M01] - Detection limit for recombinant GST tagged CDK3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
3C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Cdk3 Antibody (3C12) Summary

Immunogen
CDK3 (NP_001249, 206 a.a. ~ 305 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Specificity
CDK3 - cyclin-dependent kinase 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publication using H00001018-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cdk3 Antibody (3C12)

  • Cell division protein kinase 3
  • cyclin-dependent kinase 3
  • EC 2.7.11
  • EC 2.7.11.22

Background

This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDK2 Antibody
(OTI2D9)
NBP2-00776
Flow Cytometry: Cdk2 Antibody (2D9) [NBP2-00776] - Analysis of Hela cells, using anti-Cdk2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Cdk2 Antibody (2D9) [NBP2-00776] - Analysis of Jurkat cells, using anti-Cdk2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Cdk2 Antibody (2D9) [NBP2-00776] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Cdk2 antibody, and then analyzed by flow cytometry.
(1 Review)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues . Corresponding CDK1 RNA-seq data are presented for the same tissues.
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in human cell line A-431.
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Cyclin C Antibody
NBP2-92902
Immunocytochemistry/Immunofluorescence: Cyclin C Antibody [NBP2-92902] - Analysis of MCF7 cells using Cyclin C . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Cyclin C Antibody [NBP2-92902] - Paraffin-embedded human colon carcinoma using Cyclin C .
Immunohistochemistry-Paraffin: Cyclin C Antibody [NBP2-92902] - Paraffin-embedded human lung cancer using Cyclin C .
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Cdk5 Antibody
NBP2-15843
Western Blot: Cdk5 Antibody [NBP2-15843] - Wild-type (WT) and CDK5 knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with CDK5 antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody
Immunohistochemistry-Paraffin: Cdk5 Antibody [NBP2-15843] - ES2 xenograft, using CDK5 antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Immunocytochemistry/Immunofluorescence: Cdk5 Antibody [NBP2-15843] - Analysis of paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CDK4 Antibody
NBP1-31308
Immunocytochemistry/Immunofluorescence: CDK4 Antibody [NBP1-31308] - MCF7 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: CDK4 protein stained by CDK4 antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: CDK4 Antibody [NBP1-31308] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: CDK4 protein stained by CDK4 antibody diluted at 1:500. Red: phalloidin, a cytoskeleton marker, diluted at 1:200. Scale bar = 10 um.
Western Blot: CDK4 Antibody [NBP1-31308] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with CDK4 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
(7 Publications)
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RB1 Antibody
(172C1094) - (cleaved
NB100-56598
Knockdown Validated: RB1 Antibody (172C1094) - (cleaved) [NB100-56598] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and RB-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2 ug/ml of Mouse Anti-Human RB-1 Monoclonal Antibody (Catalog # NB100-56598) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for RB-1 at approximately 60 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunohistochemistry: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in sections of primary human breast tumors. Image courtesy of Dr. Macleod, The Ben May Institute for Cancer Research, and The University of Chicago.
Western Blot: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in HL60 cells were treated with camptothecin for 24 hours.
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Napsin A Antibody
(TMU-Ad02)
NB110-68133
Immunohistochemistry-Paraffin: Napsin-A Antibody (TMU-Ad02) [NB110-68133] - Analysis of NAPSA on human lung adenocarcinoma using NB110-68133.
Western Blot: Napsin-A Antibody (TMU-Ad02) [NB110-68133] - Analysis of NAPSA expression in human lung using NB110-68133.
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
CABLES1 Antibody
NBP2-92697
Western Blot: CABLES1 Antibody [NBP2-92697] - Analysis of extracts of various cell lines, using CABLES1 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Flow Cytometry: PCNA Antibody (PC10) [NB500-106] - An intracellular stain was performed on HepG2 cells with PCNA Antibody (PC10) NB500-106G (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 488.
(5 Reviews)
(37 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Analysis in human lymph node and liver tissues. Corresponding POLD1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human liver shows no nuclear positivity in hepatocytes as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CDK8 Antibody
NBP2-92972
Western Blot: CDK8 Antibody [NBP2-92972] - Analysis of extracts of Jurkat cells, using CDK8 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .
Western Blot: CDK8 Antibody [NBP2-92972] - Analysis of 200ug extracts of Jurkat cells, using CDK8 antibody . Western blot was performed from the immunoprecipitate using this antibody
Knockout Validated: CDK8 Antibody [NBP2-92972] - Analysis of extracts from normal (control) and CDK8 knockout (KO) HeLa cells, using CDK8 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit
(1 Review)
Species: Hu, Mu, Rt
Applications: IP, KO, WB
p19ARF/CDKN2A
Antibody
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(45 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Flow Cytometry: p15INK4b/CDKN2B Antibody (OTI3B6) [NBP2-45603] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by CDKN2B antibody.
Immunohistochemistry: p15INK4b/CDKN2B Antibody (OTI3B6) [NBP2-45603] - Analysis of Human pancreas tissue.
Immunohistochemistry: p15INK4b/CDKN2B Antibody (OTI3B6) [NBP2-45603] - Analysis of Carcinoma of Human thyroid tissue.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Carcinoma of Human thyroid tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: IHC, WB
PAK3 [p Ser144, p
Ser141, p Ser139] Ant ...
NBP2-67484
Flow Cytometry: PAK3 [p Ser144, p Ser141, p Ser139] Antibody (SU03-70) [NBP2-67484] - Analysis of NIH/3T3 cells with Phospho- PAK1(S144)+PAK2(S141)+PAK3(S139) antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used
Immunocytochemistry/Immunofluorescence: PAK3 [p Ser144, p Ser141, p Ser139] Antibody (SU03-70) [NBP2-67484] - Staining Phospho- PAK1(S144)+PAK2(S141)+PAK3(S139) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: PAK3 [p Ser144, p Ser141, p Ser139] Antibody (SU03-70) [NBP2-67484] - Staining Phospho- PAK1(S144)+PAK2(S141)+PAK3(S139) in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
c-Myc Antibody
(9E10)
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(35 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA: D4S234E Antibody (1C3) [H00027065-M01] - Detection limit for recombinant GST tagged D4S234E is approximately 0.1ng/ml as a capture antibody.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(683 Publications)
Species: Hu
Applications: BA
Cdk3 Antibody
(3C12)
H00001018-M01
Cdk3 Antibody (3C12)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for Cdk3 Antibody (H00001018-M01)(1)


Reviews for Cdk3 Antibody (H00001018-M01) (0)

There are no reviews for Cdk3 Antibody (H00001018-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cdk3 Antibody (H00001018-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Cdk3 Products

Bioinformatics Tool for Cdk3 Antibody (H00001018-M01)

Discover related pathways, diseases and genes to Cdk3 Antibody (H00001018-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdk3 Antibody (H00001018-M01)

Discover more about diseases related to Cdk3 Antibody (H00001018-M01).
 

Pathways for Cdk3 Antibody (H00001018-M01)

View related products by pathway.

PTMs for Cdk3 Antibody (H00001018-M01)

Learn more about PTMs related to Cdk3 Antibody (H00001018-M01).
 

Research Areas for Cdk3 Antibody (H00001018-M01)

Find related products by research area.

Blogs on Cdk3

There are no specific blogs for Cdk3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdk3 Antibody (3C12) and receive a gift card or discount.


Bioinformatics

Gene Symbol CDK3
Entrez
OMIM
Uniprot