Home » Cdk3 » Cdk3 Antibodies » Cdk3 Antibody (3C12)

Cdk3 Antibody (3C12)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Cdk3 Antibody (3C12) [H00001018-M01] - Analysis of CDK3 expression in transfected 293T cell line by CDK3 monoclonal antibody (M01), clone 3C12.Lane 1: CDK3 transfected lysate(35 KDa).Lane 2: Non-transfected lysate.
Western Blot: Cdk3 Antibody (3C12) [H00001018-M01] - Analysis of CDK3 expression in transfected 293T cell line by CDK3 monoclonal antibody (M01), clone 3C12.Lane 1: CDK3 transfected lysate(35 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: Cdk3 Antibody (3C12) [H00001018-M01] - Analysis of monoclonal antibody to CDK3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Sandwich ELISA: Cdk3 Antibody (3C12) [H00001018-M01] - Detection limit for recombinant GST tagged CDK3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Cdk3 Antibody (3C12) Summary

Immunogen
CDK3 (NP_001249 206 a.a. - 305 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Specificity
CDK3 - cyclin-dependent kinase 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Positive Control
Cdk3 Lysate (NBP2-66192)
Publications
Read Publication using H00001018-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cdk3 Antibody (3C12)

  • Cell division protein kinase 3
  • cyclin-dependent kinase 3
  • EC 2.7.11
  • EC 2.7.11.22

Background

This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDK2 Antibody (1A6)
NBP2-37507
Western Blot: CDK2 Antibody (1A6) [NBP2-37507] - Western blot analysis using CDK2 mouse mAb against Jurkat (1), HL-60 (2), K562(3), A431(4), HeLa(5), and NIH3T3 (6) cell lysate.
Immunocytochemistry/Immunofluorescence: CDK2 Antibody (1A6) [NBP2-37507] - Immunofluorescence analysis of HeLa cells using CDK2 mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: CDK2 Antibody (1A6) [NBP2-37507] - Immunohistochemical analysis of paraffin-embedded colon cancer tissues using CDK2 mouse mAb with DAB staining.
(1 Review)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
CDC2/CDK1 Antibody
NBP1-85729
Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues. Corresponding CDK1 RNA-seq data are presented for the same tissues.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Cyclin C Antibody
NBP1-18878
Western Blot: Cyclin C Antibody [NBP1-18878] - Whole cell lysate (50 ug) from Panc1 (P), 293T (T), Jurkat (J) and H2009 (H) cells for Western Blot. For IP, whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. NBP1-18878 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 3 ug/mg lysate.
Immunohistochemistry-Paraffin: Cyclin C Antibody [NBP1-18878] - FFPE of human skin squamous cell carcinoma. Affinity purified rabbit anti-Cyclin C dilution of 1:100.
Immunohistochemistry: Cyclin C Antibody [NBP1-18878] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-Cyclin C used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Species: Hu
Applications: WB, IHC, IHC-P, IP
Cdk5 Antibody (4E4)
NBP2-37602
Western Blot: Cdk5 Antibody (4E4) [NBP2-37602] - Western blot analysis using CDK5 mouse mAb against Hela (1), K562 (2), PC-12 (3) and Cos7 (4) cell lysate.
Immunocytochemistry/Immunofluorescence: Cdk5 Antibody (4E4) [NBP2-37602] - Immunofluorescence analysis of GC7901 cells using CDK5 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: Cdk5 Antibody (4E4) [NBP2-37602] - Analysis of paraffin-embedded cerebellum tissues (left) and brain tissues (right) using CDK5 mouse mAb with DAB staining.
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
CDK4 Antibody
NBP1-31308
Western Blot: CDK4 Antibody [NBP1-31308] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with CDK4 antibody. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: CDK4 Antibody [NBP1-31308] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: CDK4 protein stained by CDK4 antibody diluted at 1:500. Red: phalloidin, a cytoskeleton marker, diluted at 1:200. Scale bar = 10 um.
Immunohistochemistry-Paraffin: Cdk4 Antibody [NBP1-31308] - Paraffin-embedded Gastric ca, using antibody at 1:500 dilution.
(1 Publication)
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
cleaved
Retinoblastoma 1 Anti ...
NB100-56598
Western Blot: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in HL60 cells were treated with camptothecin for 24 hours.
Immunohistochemistry: cleaved Retinoblastoma 1 Antibody (172C1094) [NB100-56598] - Analysis in sections of primary human breast tumors. Image courtesy of Dr. Macleod, The Ben May Institute for Cancer Research, and The University of Chicago.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Napsin A Antibody
(TMU-Ad02)
NB110-68133
Western Blot: Napsin-A Antibody (TMU-Ad02) [NB110-68133] - Analysis of NAPSA expression in human lung using NB110-68133.
Immunohistochemistry-Paraffin: Napsin-A Antibody (TMU-Ad02) [NB110-68133] - Analysis of NAPSA on human lung adenocarcinoma using NB110-68133.
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
CABLES1 Antibody
H00091768-B01P
Western Blot: CABLES1 Antibody [H00091768-B01P] - Analysis of CABLES1 expression in transfected 293T cell line by CABLES1 polyclonal antibody. Lane 1: CABLES1 transfected lysate(40.48 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: CABLES1 Antibody [H00091768-B01P] - Analysis of purified antibody to CABLES1 on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ELISA, ICC/IF
PCNA Antibody
(PC10)
NB500-106
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: PCNA Antibody (PC10) [NB500-106] - Analysis of PCNA in mouse cornea. Image courtesy of product review by Bo-Yie Chen.
(4 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
DNA Polymerase
delta, catalytic subu ...
NBP2-33466
Western Blot: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DNA Polymerase delta, catalytic subunit Antibody [NBP2-33466] - Staining in human lymph node and liver tissues using anti-POLD1 antibody. Corresponding POLD1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
CDK8 Antibody (5H4)
H00001024-M03
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in NIH/3T3 (Cat # L018V1).
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in PC-12 (Cat # L012V1).
Western Blot: CDK8 Antibody (5H4) [H00001024-M03] - Analysis of CDK8 expression in Hela S3 NE (Cat # L013V3).
Species: Hu, Mu, Rt
Applications: WB, ELISA
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Western Blot: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CDKN2B.
Immunohistochemistry: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of Adenocarcinoma of Human endometrium tissue.
Flow Cytometry: p15INK4b/CDKN2B Antibody (3B6) [NBP2-45603] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostained by CDKN2B antibody.
Species: Hu
Applications: WB, Flow, IHC
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
PAK3 [p Ser144, p
Ser141, p Ser139] Ant ...
NBP2-67484
Immunocytochemistry/Immunofluorescence: PAK3 [p Ser144, p Ser141, p Ser139] Antibody (SU03-70) [NBP2-67484] - Staining Phospho- PAK1(S144)+PAK2(S141)+PAK3(S139) in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PAK3 [p Ser144, p Ser141, p Ser139] Antibody (SU03-70) [NBP2-67484] - Analysis of paraffin-embedded human liver cancer tissue using anti- Phospho- PAK1(S144)+PAK2(S141)+PAK3(S139) antibody. Counter stained with hematoxylin.
Flow Cytometry: PAK3 [p Ser144, p Ser141, p Ser139] Antibody (SU03-70) [NBP2-67484] - Analysis of NIH/3T3 cells with Phospho- PAK1(S144)+PAK2(S141)+PAK3(S139) antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image from the Alexa Fluor 488 version of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(38 Publications)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
D4S234E Antibody
(1C3)
H00027065-M01
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3 Analysis of D4S234E expression in IMR-32.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(492 Publications)
Species: Hu
Cdk3 Antibody
(3C12)
H00001018-M01
Cdk3 Antibody (3C12)
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for Cdk3 Antibody (H00001018-M01)(1)


Reviews for Cdk3 Antibody (H00001018-M01) (0)

There are no reviews for Cdk3 Antibody (H00001018-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cdk3 Antibody (H00001018-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Cdk3 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional Cdk3 Products

Bioinformatics Tool for Cdk3 Antibody (H00001018-M01)

Discover related pathways, diseases and genes to Cdk3 Antibody (H00001018-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdk3 Antibody (H00001018-M01)

Discover more about diseases related to Cdk3 Antibody (H00001018-M01).
 

Pathways for Cdk3 Antibody (H00001018-M01)

View related products by pathway.

PTMs for Cdk3 Antibody (H00001018-M01)

Learn more about PTMs related to Cdk3 Antibody (H00001018-M01).
 

Research Areas for Cdk3 Antibody (H00001018-M01)

Find related products by research area.

Blogs on Cdk3

There are no specific blogs for Cdk3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdk3 Antibody (3C12) and receive a gift card or discount.


Bioinformatics

Gene Symbol CDK3
Entrez
OMIM
Uniprot