Cdk3 Antibody (3C12)

Images

 
Western Blot: Cdk3 Antibody (3C12) [H00001018-M01] - Analysis of CDK3 expression in transfected 293T cell line by CDK3 monoclonal antibody (M01), clone 3C12.Lane 1: CDK3 transfected lysate(35 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: Cdk3 Antibody (3C12) [H00001018-M01] - Analysis of monoclonal antibody to CDK3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Sandwich ELISA: Cdk3 Antibody (3C12) [H00001018-M01] - Detection limit for recombinant GST tagged CDK3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cdk3 Antibody (3C12) Summary

Immunogen
CDK3 (NP_001249 206 a.a. - 305 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Specificity
CDK3 - cyclin-dependent kinase 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CDK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cdk3 Antibody (3C12)

  • Cell division protein kinase 3
  • cyclin-dependent kinase 3
  • EC 2.7.11
  • EC 2.7.11.22

Background

This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the retinoblastoma 1 protein to promote exit from G0.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18878
Species: Hu
Applications: WB, IHC-P, IP
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB110-68133
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56016
Species: Hu
Applications: WB, ICC/IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-46085
Species: Hu
Applications: WB, IHC
AF6897
Species: Hu, Mu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001018-M01
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for Cdk3 Antibody (H00001018-M01) (0)

There are no publications for Cdk3 Antibody (H00001018-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cdk3 Antibody (H00001018-M01) (0)

There are no reviews for Cdk3 Antibody (H00001018-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cdk3 Antibody (H00001018-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cdk3 Products

Bioinformatics Tool for Cdk3 Antibody (H00001018-M01)

Discover related pathways, diseases and genes to Cdk3 Antibody (H00001018-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cdk3 Antibody (H00001018-M01)

Discover more about diseases related to Cdk3 Antibody (H00001018-M01).
 

Pathways for Cdk3 Antibody (H00001018-M01)

View related products by pathway.

PTMs for Cdk3 Antibody (H00001018-M01)

Learn more about PTMs related to Cdk3 Antibody (H00001018-M01).
 

Research Areas for Cdk3 Antibody (H00001018-M01)

Find related products by research area.

Blogs on Cdk3

There are no specific blogs for Cdk3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cdk3 Antibody (3C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol CDK3
Entrez
OMIM
Uniprot