MS4A7 Antibody

Images

 
Western Blot: MS4A7 Antibody [NBP2-93062] - Analysis of extracts of mouse spleen, using MS4A7 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per ...read more

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MS4A7 Antibody Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A7 (NP_067024.1). SLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MS4A7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MS4A7 Antibody

  • 4SPAN2
  • CD20/FC-epsilon-RI-beta family member 4
  • CD20L4
  • CD20L4MGC22368
  • CFFM4
  • CFFM4CD20 antigen-like 4
  • CFFMA
  • Four-span transmembrane protein 2
  • high affinity immunoglobulin epsilon receptor beta subunit
  • membrane-spanning 4-domains subfamily A member 7
  • membrane-spanning 4-domains, subfamily A, member 7,4SPAN2
  • MS4A7
  • MS4A8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP2-67309
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
MAB6247
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00200576-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
314-BP/CF
Species: Hu
Applications: BA, BA
NBP2-45455
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
MAB6166
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
AF5627
Species: Mu
Applications: WB
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, WB
MAB2018
Species: Hu, Mu, Rt
Applications: CyTOF-reported, ICC, ICFlow, Simple Western, WB
NBP1-90895
Species: Hu
Applications: IHC, IHC-P
H00245802-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-49558
Species: Hu
Applications: IHC, IHC-P
NBP2-93062
Species: Mu
Applications: WB

Publications for MS4A7 Antibody (NBP2-93062) (0)

There are no publications for MS4A7 Antibody (NBP2-93062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MS4A7 Antibody (NBP2-93062) (0)

There are no reviews for MS4A7 Antibody (NBP2-93062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MS4A7 Antibody (NBP2-93062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MS4A7 Products

Array NBP2-93062

Bioinformatics Tool for MS4A7 Antibody (NBP2-93062)

Discover related pathways, diseases and genes to MS4A7 Antibody (NBP2-93062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MS4A7 Antibody (NBP2-93062)

Discover more about diseases related to MS4A7 Antibody (NBP2-93062).
 

Pathways for MS4A7 Antibody (NBP2-93062)

View related products by pathway.

PTMs for MS4A7 Antibody (NBP2-93062)

Learn more about PTMs related to MS4A7 Antibody (NBP2-93062).
 

Research Areas for MS4A7 Antibody (NBP2-93062)

Find related products by research area.

Blogs on MS4A7

There are no specific blogs for MS4A7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MS4A7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A7