Home » MS4A7 » MS4A7 Antibodies » MS4A7 Antibody

MS4A7 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: MS4A7 Antibody [NBP2-93062] - Analysis of extracts of mouse spleen, using MS4A7 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.
Western Blot: MS4A7 Antibody [NBP2-93062] - Analysis of extracts of mouse spleen, using MS4A7 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per ...read more

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MS4A7 Antibody Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A7 (NP_067024.1). SLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MS4A7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MS4A7 Antibody

  • 4SPAN2
  • CD20/FC-epsilon-RI-beta family member 4
  • CD20L4
  • CD20L4MGC22368
  • CFFM4
  • CFFM4CD20 antigen-like 4
  • CFFMA
  • Four-span transmembrane protein 2
  • high affinity immunoglobulin epsilon receptor beta subunit
  • membrane-spanning 4-domains subfamily A member 7
  • membrane-spanning 4-domains, subfamily A, member 7,4SPAN2
  • MS4A7
  • MS4A8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(3 Publications)
Species: Hu
Applications: BA
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Immunoblot of Balb/c thymus (lane 1) and A20 (lane 2) cell lysates with Anti-Mouse CD20 Purified.
Flow Cytometry: MS4A1/CD20 Antibody (AISB12) [NBP1-43435] - Staining of BALB/c splenocytes with Anti-Mouse CD19 Alexa Fluor (R) 647 and 1.0 micrograms conjugated anti-Mouse CD20 Purified followed by Anti-Rat IgG PE. Quadrant lines represent Rat IgG2a isotype control staining levels and cells in the lymphocyte gate were used for analysis.
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of CRC cells with Cytokeratin 20 antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Staining Cytokeratin 20 in CRC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of paraffin-embedded human colon cancer tissue using anti-Cytokeratin 20 antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
MS4A3 Antibody
(489433)
MAB6247
Human peripheral blood monocytes were stained with Human MS4A3 Monoclonal Antibody (Catalog # MAB6247, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Fluorescein-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0103B).
Species: Hu
Applications: CyTOF-ready, Flow
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
PIKFyve/PIP5K3
Antibody (6C7)
H00200576-M01
Immunocytochemistry/Immunofluorescence: PIKFyve/PIP5K3 Antibody (6C7) [H00200576-M01] - Analysis of monoclonal antibody to PIP5K3 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PIKFyve/PIP5K3 Antibody (6C7) [H00200576-M01] - Analysis of monoclonal antibody to PIP5K3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: PIKFyve/PIP5K3 Antibody (6C7) [H00200576-M01] - Analysis of PIP5K3 over-expressed 293 cell line, cotransfected with PIP5K3 Validated Chimera RNAi ( Cat # H00200576-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PIP5K3 monoclonal antibody (M01), clone 6C7 (Cat # H00200576-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
BMP-4
[Unconjugated]
314-BP/CF
1 ug/lane of Recombinant Human BMP-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 22-25 kDa and 37-41 kDa, respectively. Multiple bands in gel are due to variable glycosylation. 
Recombinant Human BMP-4 (Catalog #314-BP/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 2.5-15 ng/mL.
(440 Publications)
Species: Hu
Applications: BA, BA
MS4A12 Antibody
(OTI5F5)
NBP2-45455
Western Blot: MS4A12 Antibody (OTI5F5) [NBP2-45455] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MS4A12 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MS4A1.
Immunohistochemistry-Paraffin: MS4A12 Antibody (OTI5F5) [NBP2-45455] - Staining of paraffin-embedded Carcinoma of Human liver tissue using anti-MS4A12 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: MS4A12 Antibody (OTI5F5) [NBP2-45455] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-MS4A12 mouse monoclonal antibody.
Species: Hu
Applications: IHC, IHC-P, WB
alpha-Sarcoglycan
Antibody (JA51-81)
NBP2-67150
Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Analysis of paraffin-embedded mouse heart tissue using anti-alpha sarcoglycan antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Analysis of paraffin-embedded mouse skeletal muscle tissue using anti-alpha sarcoglycan antibody. Counter stained with hematoxylin.
Immunohistochemistry-Frozen: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Human skeletal muscle tissue. IHC-Fr image submitted by a verified customer review.
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
EOMES Antibody
(644730)
MAB6166
EOMES was detected in immersion fixed BG01V human embryonic stem cells differentiated into mesoderm using Human EOMES Monoclonal Antibody (Catalog # MAB6166) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of BG01V human embryonic stem cells untreated (-) or mesendoderm differentiated (+). PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human EOMES Monoclonal Antibody (Catalog # MAB6166) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for EOMES at approximately 100 and 80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
BG01V human embryonic stem cells differentiated to mesendoderm were stained with Mouse Anti-Human EOMES Monoclonal Antibody (Catalog # MAB6166, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Allo­phycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(4 Reviews)
(6 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
ZIP4H/Tex11
Antibody [Unconjugate
AF5627
Western blot shows lysates of 293T human embryonic kidney cell line either mock transfected, transfected with human ZIP4H, or transfected with mouse ZIP4H. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Mouse ZIP4H/Tex11 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5627) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for ZIP4H/Tex11 at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Mu
Applications: WB
NANOGP8 Antibody
H00388112-B01P
Western Blot: NANOGP8 Antibody [H00388112-B01P] - Analysis of NANOGP8 expression in transfected 293T cell line by NANOGP8 polyclonal antibody. Lane 1: NANOGP8 transfected lysate(33.55 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: WB
Nanog Antibody
[Unconjugated]
AF1997
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Nanog/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Nanog was detected in immersion fixed BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) for 3 hours at room temperature. Cells were stained with the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Nanog was detected in immersion fixed BG01V human embryonic stem cells-derived embryoid body using 10 µg/mL Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(10 Reviews)
(180 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
SOX2 Antibody
(245610) [Unconjugate
MAB2018
Simple Western lane view shows lysates of BG01V human embryonic stem cells, loaded at 0.2 mg/mL. A specific band was detected for SOX2 at approximately 50 kDa (as indicated) using 4 µg/mL of Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of NTera‑2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, D3 mouse embryonic stem cell line, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
E‑Cadherin and SOX2 were detected in BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF648) and 10 µg/mL Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018). Cells were incubated with primary antibodies for 3 hours at room temperature. Cells were stained for E‑Cadherin using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and for SOX2 using the NorthernLights 493-conjugated Anti-Mouse Secondary Antibody (green; Catalog # NL009). Cells were counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(13 Reviews)
(161 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-reported, ICC, ICFlow, Simple Western, WB
MS4A4E Antibody
NBP1-90895
Immunohistochemistry-Paraffin: MS4A4E Antibody [NBP1-90895] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells and germinal center cells.
Species: Hu
Applications: IHC, IHC-P
Recombinant Human
MS4A6E GST (N-Term) P ...
H00245802-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
CUZD1 Antibody
NBP2-49558
Immunohistochemistry-Paraffin: CUZD1 Antibody [NBP2-49558] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: CUZD1 Antibody [NBP2-49558] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: CUZD1 Antibody [NBP2-49558] - Staining in human pancreas and colon tissues using anti-CUZD1 antibody. Corresponding CUZD1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
MS4A7 Antibody
NBP2-93062
MS4A7 Antibody
Species: Mu
Applications: WB

Publications for MS4A7 Antibody (NBP2-93062) (0)

There are no publications for MS4A7 Antibody (NBP2-93062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MS4A7 Antibody (NBP2-93062) (0)

There are no reviews for MS4A7 Antibody (NBP2-93062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MS4A7 Antibody (NBP2-93062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MS4A7 Products

Array NBP2-93062

Bioinformatics Tool for MS4A7 Antibody (NBP2-93062)

Discover related pathways, diseases and genes to MS4A7 Antibody (NBP2-93062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MS4A7 Antibody (NBP2-93062)

Discover more about diseases related to MS4A7 Antibody (NBP2-93062).
 

Pathways for MS4A7 Antibody (NBP2-93062)

View related products by pathway.

PTMs for MS4A7 Antibody (NBP2-93062)

Learn more about PTMs related to MS4A7 Antibody (NBP2-93062).
 

Research Areas for MS4A7 Antibody (NBP2-93062)

Find related products by research area.

Blogs on MS4A7

There are no specific blogs for MS4A7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MS4A7 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MS4A7